DERL1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DERL1_MOUSE
• UniProt AC: Q99J56
• Protein Name: Derlin-1 {ECO:0000303|PubMed:16186509}
• Gene Name: Derl1 {ECO:0000312|MGI:MGI:1915069}
• Organism: Mus musculus (Mouse).
• Sequence Length: 251
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by forming a channel that allows the retrotranslocation of misfolded proteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and the misfolded protein. Also involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation. By controlling the steady-state expression of the IGF1R receptor, indirectly regulates the insulin-like growth factor receptor signaling pathway..
• Protein Sequence: MSDIGDWFRSIPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEAFLYRFQIWRPFTATFYFPVGPGTGFLYLVNLYFLYQYSTRLEAGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDLIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSDIGDWFR ------CCCHHHHHH	37.62	-
10	Phosphorylation	DIGDWFRSIPAITRY CHHHHHHCCHHHHHH	24.37	23684622
15	Phosphorylation	FRSIPAITRYWFAAT HHCCHHHHHHHHHHH	21.58	23684622
35	Phosphorylation	IGKLGIISPAYFFLW HHHHCCCCHHHHHHC	11.10	24719451
38	Phosphorylation	LGIISPAYFFLWPEA HCCCCHHHHHHCCHH	9.76	24719451
201	Phosphorylation	LGGRNFLSTPQFLYR CCCCCCCCCHHHHHH	33.63	22817900
202	Phosphorylation	GGRNFLSTPQFLYRW CCCCCCCCHHHHHHH	24.21	29472430
226	Phosphorylation	GFGVPPASMRRAADQ CCCCCCHHHCCHHHH	20.70	25159016

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DERL1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DERL1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DERL1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SCNNA_MOUSE	Scnn1a	physical	28137758

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.