dbPTM

DEF98_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DEF98_ARATH
UniProt AC	Q94AZ8
Protein Name	Defensin-like protein 98
Gene Name	At4g22212
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	88
Subcellular Localization	Secreted.
Protein Description
Protein Sequence	MGSLRVSTVVIAVVACLSILLISPTEVDGRLVCDTPAGTCTSSSTCNDQCNTWGGNYSGGECADSSFPGLSICYCCHYVGSSAEMESM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of DEF98_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DEF98_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DEF98_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DEF98_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
NAC89_ARATH	NAC089	physical	21798944
GASA4_ARATH	GASA4	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DEF98_ARATH

Related Literatures of Post-Translational Modification