| UniProt ID | DEF98_ARATH | |
|---|---|---|
| UniProt AC | Q94AZ8 | |
| Protein Name | Defensin-like protein 98 | |
| Gene Name | At4g22212 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 88 | |
| Subcellular Localization | Secreted. | |
| Protein Description | ||
| Protein Sequence | MGSLRVSTVVIAVVACLSILLISPTEVDGRLVCDTPAGTCTSSSTCNDQCNTWGGNYSGGECADSSFPGLSICYCCHYVGSSAEMESM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of DEF98_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DEF98_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DEF98_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DEF98_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NAC89_ARATH | NAC089 | physical | 21798944 | |
| GASA4_ARATH | GASA4 | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...