GASA4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GASA4_ARATH
• UniProt AC: P46690
• Protein Name: Gibberellin-regulated protein 4
• Gene Name: GASA4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 106
• Subcellular Localization: Secreted.
• Protein Description: Gibberellin-regulated protein involved in the regulation of floral meristem and floral organ identity, and promotion of seed size and weight. May play a role in the promotion of gibberellin responses such as regulation of flowering under short-day conditions, seed germination and inhibition of gibberellin oxidase. Possesses redox activity in E.coli and may function in redox regulation in planta..
• Protein Sequence: MAKSYGAIFLLTLIVLFMLQTMVMASSGSNVKWSQKRYGPGSLKRTQCPSECDRRCKKTQYHKACITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GASA4_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GASA4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GASA4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GASA4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.