UniProt ID | GASA4_ARATH | |
---|---|---|
UniProt AC | P46690 | |
Protein Name | Gibberellin-regulated protein 4 | |
Gene Name | GASA4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 106 | |
Subcellular Localization | Secreted. | |
Protein Description | Gibberellin-regulated protein involved in the regulation of floral meristem and floral organ identity, and promotion of seed size and weight. May play a role in the promotion of gibberellin responses such as regulation of flowering under short-day conditions, seed germination and inhibition of gibberellin oxidase. Possesses redox activity in E.coli and may function in redox regulation in planta.. | |
Protein Sequence | MAKSYGAIFLLTLIVLFMLQTMVMASSGSNVKWSQKRYGPGSLKRTQCPSECDRRCKKTQYHKACITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GASA4_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GASA4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GASA4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GASA4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...