DDIT3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DDIT3_MOUSE
• UniProt AC: P35639
• Protein Name: DNA damage-inducible transcript 3 protein
• Gene Name: Ddit3
• Organism: Mus musculus (Mouse).
• Sequence Length: 168
• Subcellular Localization: Cytoplasm. Nucleus. Present in the cytoplasm under non-stressed conditions and ER stress leads to its nuclear accumulation.
• Protein Description: Multifunctional transcription factor in ER stress response. Plays an essential role in the response to a wide variety of cell stresses and induces cell cycle arrest and apoptosis in response to ER stress. Plays a dual role both as an inhibitor of CCAAT/enhancer-binding protein (C/EBP) function and as an activator of other genes. Acts as a dominant-negative regulator of C/EBP-induced transcription: dimerizes with members of the C/EBP family, impairs their association with C/EBP binding sites in the promoter regions, and inhibits the expression of C/EBP regulated genes. Positively regulates the transcription of TRIB3, IL6, IL8, IL23, TNFRSF10B/DR5, PPP1R15A/GADD34, BBC3/PUMA, BCL2L11/BIM and ERO1L. Negatively regulates; expression of BCL2 and MYOD1, ATF4-dependent transcriptional activation of asparagine synthetase (ASNS), CEBPA-dependent transcriptional activation of hepcidin (HAMP) and CEBPB-mediated expression of peroxisome proliferator-activated receptor gamma (PPARG). Inhibits the canonical Wnt signaling pathway by binding to TCF7L2/TCF4, impairing its DNA-binding properties and repressing its transcriptional activity. Plays a regulatory role in the inflammatory response through the induction of caspase-11 (CASP4/CASP11) which induces the activation of caspase-1 (CASP1) and both these caspases increase the activation of pro-IL1B to mature IL1B which is involved in the inflammatory response. Acts as a major regulator of postnatal neovascularization through regulation of endothelial nitric oxide synthase (NOS3)-related signaling..
• Protein Sequence: MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	PFTLETVSSWELEAW CCEEECCCCHHHHHH	36.83	12876286
15	Phosphorylation	FTLETVSSWELEAWY CEEECCCCHHHHHHH	21.89	12876286
30	Phosphorylation	EDLQEVLSSDEIGGT HHHHHHHHCCCCCCE	40.70	12876286
31	Phosphorylation	DLQEVLSSDEIGGTY HHHHHHHCCCCCCEE	34.79	12876286
75	Phosphorylation	GPTEVTRTSQSPRSP CCCCCEECCCCCCCC	23.04	30635358
76	Phosphorylation	PTEVTRTSQSPRSPD CCCCEECCCCCCCCC	25.93	30635358
78	Phosphorylation	EVTRTSQSPRSPDSS CCEECCCCCCCCCCC	23.27	8650547
81	Phosphorylation	RTSQSPRSPDSSQSS ECCCCCCCCCCCCCH	36.12	8650547
84	Phosphorylation	QSPRSPDSSQSSMAQ CCCCCCCCCCCHHHH	33.39	26643407
85	Phosphorylation	SPRSPDSSQSSMAQE CCCCCCCCCCHHHHH	41.27	26643407
87	Phosphorylation	RSPDSSQSSMAQEEE CCCCCCCCHHHHHHH	24.83	26643407
88	Phosphorylation	SPDSSQSSMAQEEEE CCCCCCCHHHHHHHH	15.53	26643407
107	Phosphorylation	RTRKRKQSGQCPARP HHHHHHHHCCCCCCC	33.59	23684622
120	Ubiquitination	RPGKQRMKEKEQENE CCCHHHHHHHHHHHH	68.75	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
14	S	Phosphorylation	Kinase	CK2	-	Uniprot
15	S	Phosphorylation	Kinase	CK2	-	Uniprot
30	S	Phosphorylation	Kinase	CK2	-	Uniprot
31	S	Phosphorylation	Kinase	CK2	-	Uniprot
78	S	Phosphorylation	Kinase	MAPKAPK2	P49138	GPS
78	S	Phosphorylation	Kinase	MAPK1	P63085	GPS
78	S	Phosphorylation	Kinase	MAPK14	P47811	Uniprot
81	S	Phosphorylation	Kinase	MAPKAPK2	P49138	GPS
81	S	Phosphorylation	Kinase	MAPK14	P47811	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DDIT3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DDIT3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CERS2_MOUSE	Cers2	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.