dbPTM

DCTD_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DCTD_DROME
UniProt AC	Q9VWA2
Protein Name	Probable deoxycytidylate deaminase
Gene Name	CG6951
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	203
Subcellular Localization
Protein Description	Supplies the nucleotide substrate for thymidylate synthetase..
Protein Sequence	MAEVSAQDLISQLSKSPESHKRKEYLHWDDYFMATSLLSAKRSKDPVTQVGACIVDSQNRIVAIGYNGFPRNCSDDVFPWSKAKKGSQEFDPLEDKKMYVVHAEANAILNSNGMSLSGTRLYTTLFPCNECAKLIIQVGISQVLYLSDKYADKPTYRASKRMLDAVGVEYKRHIPQKKTITIDFDTFPEEDPNASLGLNELHL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
87	Phosphorylation	WSKAKKGSQEFDPLE HHHCCCCCCCCCCCC	35.10	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DCTD_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DCTD_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DCTD_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
DCTD_DROME	CG6951	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DCTD_DROME

Related Literatures of Post-Translational Modification