DCN1_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DCN1_CAEEL
• UniProt AC: Q9U3C8
• Protein Name: Defective in cullin neddylation protein 1
• Gene Name: dcn-1
• Organism: Caenorhabditis elegans.
• Sequence Length: 295
• Subcellular Localization: Nucleus .
• Protein Description: Required for neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity. Does not act by preventing deneddylation, but rather facilitates neddylation, possibly by acting with rbx-1 to recruit the Nedd8-charged E2 enzyme to the cullin component of SCF-type complexes..
• Protein Sequence: MNRLKSDQKTKLRQFVQWTQVTEAVSLNFLAKANWNIEYAMTLYFDNPNLFAGSTPQPSVDRSNIERLFNQYVDPKDKVGEKRMGPHGINRLLTDLGYEATDRRVLVLAWKFTAQTQCEFSLDEWVKGMTALQADTVQNLRQRIDSINSGLESDKAKFHELYLFAFNYAKSAACRNLDLETAICCWDVLFGQRSTIMTQWIDFLWAQENAAASRLAQNVGASNAKQFKSVWISRDTWNLFWDFILLSKPDLSDYDDEGAWPVLIDQFVDYCRENLNYPKPGNASNDQQMETPSYY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of DCN1_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DCN1_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DCN1_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DCN1_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBIQ1_CAEEL	ubq-1	physical	15988528
NEDD8_CAEEL	ned-8	physical	15988528
CUL3_CAEEL	cul-3	physical	15988528

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.