| UniProt ID | CYTD_HUMAN | |
|---|---|---|
| UniProt AC | P28325 | |
| Protein Name | Cystatin-D | |
| Gene Name | CST5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 142 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Cysteine proteinase inhibitor that possibly plays a protective role against proteinases present in the oral cavity. The order of preference for inhibition is cathepsin S > cathepsin H > cathepsin L > cathepsin B.. | |
| Protein Sequence | MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MMWPMHTPLLLLTA -CCCCCCHHHHHHHH | 14.91 | 24043423 | |
| 13 | Phosphorylation | HTPLLLLTALMVAVA CHHHHHHHHHHHHHH | 20.09 | 24043423 | |
| 22 | Phosphorylation | LMVAVAGSASAQSRT HHHHHHCCHHHHHCH | 14.87 | 24043423 | |
| 24 | Phosphorylation | VAVAGSASAQSRTLA HHHHCCHHHHHCHHC | 28.65 | 24043423 | |
| 27 | Phosphorylation | AGSASAQSRTLAGGI HCCHHHHHCHHCCCE | 27.27 | 24043423 | |
| 29 | Phosphorylation | SASAQSRTLAGGIHA CHHHHHCHHCCCEEE | 26.63 | 24043423 | |
| 37 | Phosphorylation | LAGGIHATDLNDKSV HCCCEEEECCCCHHH | 27.19 | 24043423 | |
| 75 | Phosphorylation | PLQVMAAYQQIVGGV HHHHHHHHHHHHCCC | 7.45 | 25404012 | |
| 84 | Phosphorylation | QIVGGVNYYFNVKFG HHHCCCCEEEEEEEC | 13.66 | 25404012 | |
| 85 | Phosphorylation | IVGGVNYYFNVKFGR HHCCCCEEEEEEECC | 5.40 | 25404012 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYTD_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYTD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYTD_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CATS_HUMAN | CTSS | physical | 8083219 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
