| UniProt ID | CATS_HUMAN | |
|---|---|---|
| UniProt AC | P25774 | |
| Protein Name | Cathepsin S | |
| Gene Name | CTSS | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 331 | |
| Subcellular Localization | Lysosome. | |
| Protein Description | Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L.. | |
| Protein Sequence | MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | Phosphorylation | HWHLWKKTYGKQYKE HHHHHHHHHCHHHHH | 33.51 | 28152594 | |
| 35 | Phosphorylation | WHLWKKTYGKQYKEK HHHHHHHHCHHHHHH | 31.07 | 28152594 | |
| 42 | Ubiquitination | YGKQYKEKNEEAVRR HCHHHHHHCHHHHHH | 66.56 | - | |
| 72 | Phosphorylation | EHSMGMHSYDLGMNH CHHCCCCHHCCCCCC | 16.08 | 22210691 | |
| 73 | Phosphorylation | HSMGMHSYDLGMNHL HHCCCCHHCCCCCCC | 10.66 | 22210691 | |
| 93 | Phosphorylation | EEVMSLMSSLRVPSQ HHHHHHHHHCCCCCH | 31.36 | 22210691 | |
| 104 | N-linked_Glycosylation | VPSQWQRNITYKSNP CCCHHHCCCCCCCCC | 18.82 | 9524075 | |
| 171 | Phosphorylation | AQNLVDCSTEKYGNK CCCCCCCCCHHCCCC | 34.83 | - | |
| 175 | Phosphorylation | VDCSTEKYGNKGCNG CCCCCHHCCCCCCCC | 21.50 | - | |
| 200 | Phosphorylation | IDNKGIDSDASYPYK HCCCCCCCCCCCCHH | 32.91 | - | |
| 215 | Phosphorylation | AMDQKCQYDSKYRAA HHCCCCCCCHHCCCC | 31.49 | 22461510 | |
| 217 | Phosphorylation | DQKCQYDSKYRAATC CCCCCCCHHCCCCCC | 27.01 | 22461510 | |
| 232 | Phosphorylation | SKYTELPYGREDVLK CCCCCCCCCCHHHHH | 41.25 | - | |
| 262 | Phosphorylation | RHPSFFLYRSGVYYE CCCCEEEEECCCEEC | 9.51 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CATS_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CATS_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CATS_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CATS_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
