UniProt ID | CYS1_MOUSE | |
---|---|---|
UniProt AC | Q8R4T1 | |
Protein Name | Cystin-1 | |
Gene Name | Cys1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 145 | |
Subcellular Localization |
Cell projection, cilium membrane Lipid-anchor. Cytoplasm, cytoskeleton, cilium axoneme. Localization to cilium is mediated via interaction with UNC119 and UNC119B, which bind to the myristoyl moiety of the N-terminus (By similarity). Expression is e |
|
Protein Description | ||
Protein Sequence | MGSGSSRSGRIPRRRRSPDRRQTGPGETASEGGTADQAPTAAGQEESGRDPRPATPSGGREETLRLLDQLLAESEAWGPQELTPRGPARLAPAVSPEKKVKGNPEDSCASEAPGNSPKRPEGQSAISYDYSEEELMASIEREYCR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | N-myristoyl glycine | ------MGSGSSRSG ------CCCCCCCCC | 40.49 | - | |
2 | Myristoylation | ------MGSGSSRSG ------CCCCCCCCC | 40.49 | 19850956 | |
47 | Phosphorylation | TAAGQEESGRDPRPA CHHCCCCCCCCCCCC | 38.07 | 23140645 | |
55 | Phosphorylation | GRDPRPATPSGGREE CCCCCCCCCCCCHHH | 22.22 | 22817900 | |
95 | Phosphorylation | ARLAPAVSPEKKVKG CCCCCCCCCCCCCCC | 29.46 | 26824392 | |
110 | Phosphorylation | NPEDSCASEAPGNSP CHHHCCCCCCCCCCC | 38.32 | 27742792 | |
116 | Phosphorylation | ASEAPGNSPKRPEGQ CCCCCCCCCCCCCCC | 37.40 | 25521595 | |
130 | Phosphorylation | QSAISYDYSEEELMA CCCCCCCCCHHHHHH | 15.11 | 29899451 | |
131 | Phosphorylation | SAISYDYSEEELMAS CCCCCCCCHHHHHHH | 35.32 | 29899451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYS1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYS1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYS1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NECD_MOUSE | Ndn | physical | 24349431 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Myristoylation | |
Reference | PubMed |
"Cystin localizes to primary cilia via membrane microdomains and atargeting motif."; Tao B., Bu S., Yang Z., Siroky B., Kappes J.C., Kispert A.,Guay-Woodford L.M.; J. Am. Soc. Nephrol. 20:2570-2580(2009). Cited for: SUBCELLULAR LOCATION, CILIARY TARGETING MOTIF, AND MYRISTOYLATION ATGLY-2. |