| UniProt ID | CYS1_MOUSE | |
|---|---|---|
| UniProt AC | Q8R4T1 | |
| Protein Name | Cystin-1 | |
| Gene Name | Cys1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 145 | |
| Subcellular Localization |
Cell projection, cilium membrane Lipid-anchor. Cytoplasm, cytoskeleton, cilium axoneme. Localization to cilium is mediated via interaction with UNC119 and UNC119B, which bind to the myristoyl moiety of the N-terminus (By similarity). Expression is e |
|
| Protein Description | ||
| Protein Sequence | MGSGSSRSGRIPRRRRSPDRRQTGPGETASEGGTADQAPTAAGQEESGRDPRPATPSGGREETLRLLDQLLAESEAWGPQELTPRGPARLAPAVSPEKKVKGNPEDSCASEAPGNSPKRPEGQSAISYDYSEEELMASIEREYCR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | N-myristoyl glycine | ------MGSGSSRSG ------CCCCCCCCC | 40.49 | - | |
| 2 | Myristoylation | ------MGSGSSRSG ------CCCCCCCCC | 40.49 | 19850956 | |
| 47 | Phosphorylation | TAAGQEESGRDPRPA CHHCCCCCCCCCCCC | 38.07 | 23140645 | |
| 55 | Phosphorylation | GRDPRPATPSGGREE CCCCCCCCCCCCHHH | 22.22 | 22817900 | |
| 95 | Phosphorylation | ARLAPAVSPEKKVKG CCCCCCCCCCCCCCC | 29.46 | 26824392 | |
| 110 | Phosphorylation | NPEDSCASEAPGNSP CHHHCCCCCCCCCCC | 38.32 | 27742792 | |
| 116 | Phosphorylation | ASEAPGNSPKRPEGQ CCCCCCCCCCCCCCC | 37.40 | 25521595 | |
| 130 | Phosphorylation | QSAISYDYSEEELMA CCCCCCCCCHHHHHH | 15.11 | 29899451 | |
| 131 | Phosphorylation | SAISYDYSEEELMAS CCCCCCCCHHHHHHH | 35.32 | 29899451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYS1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYS1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYS1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NECD_MOUSE | Ndn | physical | 24349431 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Myristoylation | |
| Reference | PubMed |
| "Cystin localizes to primary cilia via membrane microdomains and atargeting motif."; Tao B., Bu S., Yang Z., Siroky B., Kappes J.C., Kispert A.,Guay-Woodford L.M.; J. Am. Soc. Nephrol. 20:2570-2580(2009). Cited for: SUBCELLULAR LOCATION, CILIARY TARGETING MOTIF, AND MYRISTOYLATION ATGLY-2. | |