UniProt ID | CYH4_HUMAN | |
---|---|---|
UniProt AC | Q9UIA0 | |
Protein Name | Cytohesin-4 | |
Gene Name | CYTH4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 394 | |
Subcellular Localization |
Cell membrane Peripheral membrane protein . |
|
Protein Description | Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF factors through replacement of GDP with GTP.. | |
Protein Sequence | MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSAEERDQWIESIRASITRVPFYDLVSTRKKKIASKQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | HPEPAELSSGETEEL CCCCCCCCCCCHHHH | 28.00 | 28450419 | |
13 | Phosphorylation | PEPAELSSGETEELQ CCCCCCCCCCHHHHH | 53.96 | 28450419 | |
16 | Phosphorylation | AELSSGETEELQRIK CCCCCCCHHHHHHHH | 37.98 | 28450419 | |
102 | Ubiquitination | DIARFLYKGEGLNKT HHHHHHHCCCCCCCH | 53.27 | - | |
109 | Phosphorylation | KGEGLNKTAIGTYLG CCCCCCCHHHHHHCC | 23.57 | 24719451 | |
114 | Phosphorylation | NKTAIGTYLGERDPI CCHHHHHHCCCCCCC | 13.90 | 24719451 | |
159 | Ubiquitination | RLPGEAQKIDRMMEA CCCCHHHHHHHHHHH | 54.33 | - | |
215 | Phosphorylation | PPFERFVSMNRGINN CCHHHHHCCCCCCCC | 13.97 | 23532336 | |
268 | Ubiquitination | DREGWLLKLGGRVKT CCCEEEEEECCEECE | 42.80 | - | |
275 | Phosphorylation | KLGGRVKTWKRRWFI EECCEECEEEEEEEE | 33.10 | 24719451 | |
356 | Phosphorylation | KHESYRISATSAEER CCCEEEEECCCHHHH | 19.25 | 29759185 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYH4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYH4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYH4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AMOL2_HUMAN | AMOTL2 | physical | 25416956 | |
TRI54_HUMAN | TRIM54 | physical | 25416956 | |
K1C40_HUMAN | KRT40 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale characterization of HeLa cell nuclear phosphoproteins."; Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J.,Li J., Cohn M.A., Cantley L.C., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-356, AND MASSSPECTROMETRY. |