CYH3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CYH3_MOUSE
• UniProt AC: O08967
• Protein Name: Cytohesin-3
• Gene Name: Cyth3
• Organism: Mus musculus (Mouse).
• Sequence Length: 399
• Subcellular Localization: Cytoplasm, cytosol. Cell membrane ; Peripheral membrane protein . Cell junction, adherens junction . Cell junction, tight junction . Translocates from the cytosol to membranes enriched in phosphatidylinositol 3,4,5-trisphosphate.
• Protein Description: Promotes guanine-nucleotide exchange on ARF1. Promotes the activation of ARF factors through replacement of GDP with GTP. [PubMed: 18042453 Play a role in the epithelial polarization]
• Protein Sequence: MDEGGGGEGGSVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	GGGGEGGSVPEDLSL CCCCCCCCCCCCCCH	45.41	25338131
114	Phosphorylation	KGEGLNKTVIGDYLG CCCCCCCEEEHHHCC	19.11	25159016
155	Phosphorylation	ALRQFLWSFRLPGEA HHHHHHHHCCCCCHH	11.57	22609160
164	Ubiquitination	RLPGEAQKIDRMMEA CCCCHHHHHHHHHHH	54.33	-
280	Phosphorylation	KLGGRVKTWKRRWFI EECCEECEEEEEEEE	33.10	22609160
385	Phosphorylation	SISRDPFYDMLATRK HHHCCCHHHHHHHHH	13.06	29514104
390	Phosphorylation	PFYDMLATRKRRIAN CHHHHHHHHHHHHHC	32.53	29899451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
155	S	Phosphorylation	Kinase	AKT1	P31749	PSP
280	T	Phosphorylation	Kinase	AKT1	P31749	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CYH3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CYH3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FRM4B_MOUSE	Frmd4b	physical	11445584

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.