UniProt ID | CYAC3_HUMAN | |
---|---|---|
UniProt AC | Q8NBI2 | |
Protein Name | Cytochrome b ascorbate-dependent protein 3 | |
Gene Name | CYB561A3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 242 | |
Subcellular Localization |
Late endosome membrane Multi-pass membrane protein. Lysosome membrane Multi-pass membrane protein . |
|
Protein Description | Ferric-chelate reductase that reduces Fe(3+) to Fe(2+) before its transport from the endosome to the cytoplasm. Probably uses ascorbate as electron donor (By similarity).. | |
Protein Sequence | MVSGRFYLSCLLLGSLGSMCILFTIYWMQYWRGGFAWNGSIYMFNWHPVLMVAGMVVFYGGASLVYRLPQSWVGPKLPWKLLHAALHLMAFVLTVVGLVAVFTFHNHGRTANLYSLHSWLGITTVFLFACQWFLGFAVFLLPWASMWLRSLLKPIHVFFGAAILSLSIASVISGINEKLFFSLKNTTRPYHSLPSEAVFANSTGMLVVAFGLLVLYILLASSWKRPEPGILTDRQPLLHDGE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 (in isoform 2) | Phosphorylation | - | 9.09 | 30108239 | |
8 (in isoform 2) | Phosphorylation | - | 2.40 | 30108239 | |
11 (in isoform 2) | Phosphorylation | - | 3.88 | 30108239 | |
38 | N-linked_Glycosylation | WRGGFAWNGSIYMFN HCCCCCCCCEEEEEE | 30.79 | UniProtKB CARBOHYD | |
150 | Phosphorylation | WASMWLRSLLKPIHV HHHHHHHHHHHHHHH | 35.56 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYAC3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYAC3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYAC3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AOC1_HUMAN | AOC1 | physical | 21516116 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...