| UniProt ID | CYAC3_HUMAN | |
|---|---|---|
| UniProt AC | Q8NBI2 | |
| Protein Name | Cytochrome b ascorbate-dependent protein 3 | |
| Gene Name | CYB561A3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 242 | |
| Subcellular Localization |
Late endosome membrane Multi-pass membrane protein. Lysosome membrane Multi-pass membrane protein . |
|
| Protein Description | Ferric-chelate reductase that reduces Fe(3+) to Fe(2+) before its transport from the endosome to the cytoplasm. Probably uses ascorbate as electron donor (By similarity).. | |
| Protein Sequence | MVSGRFYLSCLLLGSLGSMCILFTIYWMQYWRGGFAWNGSIYMFNWHPVLMVAGMVVFYGGASLVYRLPQSWVGPKLPWKLLHAALHLMAFVLTVVGLVAVFTFHNHGRTANLYSLHSWLGITTVFLFACQWFLGFAVFLLPWASMWLRSLLKPIHVFFGAAILSLSIASVISGINEKLFFSLKNTTRPYHSLPSEAVFANSTGMLVVAFGLLVLYILLASSWKRPEPGILTDRQPLLHDGE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 (in isoform 2) | Phosphorylation | - | 9.09 | 30108239 | |
| 8 (in isoform 2) | Phosphorylation | - | 2.40 | 30108239 | |
| 11 (in isoform 2) | Phosphorylation | - | 3.88 | 30108239 | |
| 38 | N-linked_Glycosylation | WRGGFAWNGSIYMFN HCCCCCCCCEEEEEE | 30.79 | UniProtKB CARBOHYD | |
| 150 | Phosphorylation | WASMWLRSLLKPIHV HHHHHHHHHHHHHHH | 35.56 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYAC3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYAC3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYAC3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AOC1_HUMAN | AOC1 | physical | 21516116 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...