| UniProt ID | CXL13_HUMAN | |
|---|---|---|
| UniProt AC | O43927 | |
| Protein Name | C-X-C motif chemokine 13 | |
| Gene Name | CXCL13 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 109 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.. | |
| Protein Sequence | MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Phosphorylation | LLLMLLVSSLSPVQG HHHHHHHHCCCCCCC | 26.07 | 25954137 | |
| 28 | Phosphorylation | QGVLEVYYTSLRCRC CCHHHHHHEEEEEEE | 8.60 | 25954137 | |
| 39 | Phosphorylation | RCRCVQESSVFIPRR EEEEEECCCEEEEHH | 18.08 | - | |
| 40 | Phosphorylation | CRCVQESSVFIPRRF EEEEECCCEEEEHHH | 21.94 | - | |
| 63 | Sumoylation | RGNGCPRKEIIVWKK CCCCCCCCEEEEEEC | 38.11 | - | |
| 63 | Sumoylation | RGNGCPRKEIIVWKK CCCCCCCCEEEEEEC | 38.11 | - | |
| 69 | Ubiquitination | RKEIIVWKKNKSIVC CCEEEEEECCCEEEE | 35.26 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CXL13_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CXL13_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CXL13_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| EF1G_HUMAN | EEF1G | physical | 16169070 | |
| CDN1A_HUMAN | CDKN1A | physical | 24027428 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...