UniProt ID | CXL13_HUMAN | |
---|---|---|
UniProt AC | O43927 | |
Protein Name | C-X-C motif chemokine 13 | |
Gene Name | CXCL13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 109 | |
Subcellular Localization | Secreted. | |
Protein Description | Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.. | |
Protein Sequence | MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | LLLMLLVSSLSPVQG HHHHHHHHCCCCCCC | 26.07 | 25954137 | |
28 | Phosphorylation | QGVLEVYYTSLRCRC CCHHHHHHEEEEEEE | 8.60 | 25954137 | |
39 | Phosphorylation | RCRCVQESSVFIPRR EEEEEECCCEEEEHH | 18.08 | - | |
40 | Phosphorylation | CRCVQESSVFIPRRF EEEEECCCEEEEHHH | 21.94 | - | |
63 | Sumoylation | RGNGCPRKEIIVWKK CCCCCCCCEEEEEEC | 38.11 | - | |
63 | Sumoylation | RGNGCPRKEIIVWKK CCCCCCCCEEEEEEC | 38.11 | - | |
69 | Ubiquitination | RKEIIVWKKNKSIVC CCEEEEEECCCEEEE | 35.26 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CXL13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CXL13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CXL13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EF1G_HUMAN | EEF1G | physical | 16169070 | |
CDN1A_HUMAN | CDKN1A | physical | 24027428 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...