CXL11_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CXL11_HUMAN
• UniProt AC: O14625
• Protein Name: C-X-C motif chemokine 11
• Gene Name: CXCL11
• Organism: Homo sapiens (Human).
• Sequence Length: 94
• Subcellular Localization: Secreted.
• Protein Description: Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses..
• Protein Sequence: MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSVKGMAIA ------CCHHHHHHH	32.32	24719451
27	Citrullination	QGFPMFKRGRCLCIG CCCCCCCCCEEEEEC	26.90	-
27	Citrullination	QGFPMFKRGRCLCIG CCCCCCCCCEEEEEC	26.90	18645041
49	Phosphorylation	VADIEKASIMYPSNN ECCCCCCEEEECCCC	20.96	26074081
52	Phosphorylation	IEKASIMYPSNNCDK CCCCEEEECCCCCCE	11.22	26074081
54	Phosphorylation	KASIMYPSNNCDKIE CCEEEECCCCCCEEE	24.16	26074081
65	Phosphorylation	DKIEVIITLKENKGQ CEEEEEEEEECCCCC	22.21	26074081

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CXL11_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CXL11_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CXL11_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MTUS2_HUMAN	MTUS2	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.