UniProt ID | CXL11_HUMAN | |
---|---|---|
UniProt AC | O14625 | |
Protein Name | C-X-C motif chemokine 11 | |
Gene Name | CXCL11 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 94 | |
Subcellular Localization | Secreted. | |
Protein Description | Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.. | |
Protein Sequence | MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSVKGMAIA ------CCHHHHHHH | 32.32 | 24719451 | |
27 | Citrullination | QGFPMFKRGRCLCIG CCCCCCCCCEEEEEC | 26.90 | - | |
27 | Citrullination | QGFPMFKRGRCLCIG CCCCCCCCCEEEEEC | 26.90 | 18645041 | |
49 | Phosphorylation | VADIEKASIMYPSNN ECCCCCCEEEECCCC | 20.96 | 26074081 | |
52 | Phosphorylation | IEKASIMYPSNNCDK CCCCEEEECCCCCCE | 11.22 | 26074081 | |
54 | Phosphorylation | KASIMYPSNNCDKIE CCEEEECCCCCCEEE | 24.16 | 26074081 | |
65 | Phosphorylation | DKIEVIITLKENKGQ CEEEEEEEEECCCCC | 22.21 | 26074081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CXL11_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CXL11_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CXL11_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MTUS2_HUMAN | MTUS2 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...