CXD3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CXD3_HUMAN
• UniProt AC: Q8N144
• Protein Name: Gap junction delta-3 protein
• Gene Name: GJD3
• Organism: Homo sapiens (Human).
• Sequence Length: 294
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein . Cell junction, gap junction .
• Protein Description: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell..
• Protein Sequence: MGEWAFLGSLLDAVQLQSPLVGRLWLVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLFHILLLSAPPVLFVVYSMHRAGKEAGGAEAAAQCAPGLPEAQCAPCALRARRARRCYLLSVALRLLAELTFLGGQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLFYFAVGLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPPPALPSRRPGPEPCAPPAYAHPAPASLRECGSGRGKASPATGRRDLAI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	LDAVQLQSPLVGRLW HHHHHHCCHHHHHHH	28.88	24043423

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CXD3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CXD3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CXD3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZO1_HUMAN	TJP1	physical	12154091

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.