CXCL5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CXCL5_HUMAN
• UniProt AC: P42830
• Protein Name: C-X-C motif chemokine 5
• Gene Name: CXCL5
• Organism: Homo sapiens (Human).
• Sequence Length: 114
• Subcellular Localization: Secreted.
• Protein Description: Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes..
• Protein Sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSLLSSRAA ------CCCCCCCCC	37.71	21406692
5	Phosphorylation	---MSLLSSRAARVP ---CCCCCCCCCCCC	24.07	21406692
6	Phosphorylation	--MSLLSSRAARVPG --CCCCCCCCCCCCC	26.38	24719451
100	2-Hydroxyisobutyrylation	DPEAPFLKKVIQKIL CCCCHHHHHHHHHHH	45.43	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CXCL5_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CXCL5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CXCL5_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NT2NL_HUMAN	NOTCH2NL	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.