CTR4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CTR4_SCHPO
• UniProt AC: O94722
• Protein Name: Copper transport protein ctr4
• Gene Name: ctr4
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 289
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Required for high affinity copper (probably reduced Cu I) transport into the cell..
• Protein Sequence: MSFFSAAKQSLGNSLIKLGTSMAQNSQGPVDDSSLSQLENLLPPLQILTARAAMAAMNMSNDTSMSGMNMTNSTTPMSGMNMTNSTTSMSGMNMSNSTTSMSGMNMTNTTTTAKASSCKLSMYWNWYTIDACFITKHWHITSKHMFVGSIFGIIFMMMALELVRRGQREFDRWCVRRFSPASNSCCHSGAPVHSGPSMALRIFLHFLRSCFYLVQYIVAYIAMLLAMYYNGYVILFLFCGTFFGYFLFGADTISTKASSSVQTKTIVQVADEKHEHDSSQYSDTTPTTE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
278	Phosphorylation	DEKHEHDSSQYSDTT CCCCCCCCCCCCCCC	22.65	21712547
279	Phosphorylation	EKHEHDSSQYSDTTP CCCCCCCCCCCCCCC	38.91	28889911
281	Phosphorylation	HEHDSSQYSDTTPTT CCCCCCCCCCCCCCC	15.51	24763107
282	Phosphorylation	EHDSSQYSDTTPTTE CCCCCCCCCCCCCCC	22.35	24763107
284	Phosphorylation	DSSQYSDTTPTTE-- CCCCCCCCCCCCC--	28.83	21712547
285	Phosphorylation	SSQYSDTTPTTE--- CCCCCCCCCCCC---	24.51	25720772
287	Phosphorylation	QYSDTTPTTE----- CCCCCCCCCC-----	41.27	25720772
288	Phosphorylation	YSDTTPTTE------ CCCCCCCCC------	40.68	27738172

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CTR4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CTR4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CTR4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CTR5_SCHPO	ctr5	genetic	16385131
CTR5_SCHPO	ctr5	physical	20694150
CTR4_SCHPO	ctr4	physical	20694150
CTR4_SCHPO	ctr4	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of fission yeast.";
Wilson-Grady J.T., Villen J., Gygi S.P.;
J. Proteome Res. 7:1088-1097(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-279, AND MASSSPECTROMETRY.
PubMed: 18257517