CSK2C_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CSK2C_DROME
• UniProt AC: O96863
• Protein Name: Casein kinase II subunit beta'
• Gene Name: CkIIbeta2
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 219
• Protein Description: Participates in Wnt signaling (By similarity). Plays a complex role in regulating the basal catalytic activity of the alpha subunit..
• Protein Sequence: MTDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASEDPAEPELEASAEKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSDNPGEDMVRIYCPKCNDVYIPKASRHSNLDGAFFGTGFPHMFFMEKPDARPKRAKQKFVPRLYGFKIHPTAYRTAAEIQKDVTMTPVGEIDSPSHI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTDSDESSW ------CCCCCCHHH	44.18	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CSK2C_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CSK2C_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CSK2C_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSK2A_DROME	CkIIalpha	physical	10329473

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.