| UniProt ID | CSH1_HUMAN | |
|---|---|---|
| UniProt AC | P0DML2 | |
| Protein Name | Chorionic somatomammotropin hormone 1 | |
| Gene Name | CSH1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 217 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Produced only during pregnancy and is involved in stimulating lactation, fetal growth and metabolism. Does not interact with GHR but only activates PRLR through zinc-induced dimerization.. | |
| Protein Sequence | MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Sulfoxidation | TSLLLAFALLCLPWL HHHHHHHHHHHHHHH | 3571265 | ||
| 64 | Sulfoxidation | FEETYIPKDQKYSFL HHHHCCCCCCCEEEE | 3571265 | ||
| 93 | Phosphorylation | TPSNMEETQQKSNLE CCCCHHHHHHHHHHH | - | ||
| 96 | Sulfoxidation | NMEETQQKSNLELLR CHHHHHHHHHHHHHH | 3571265 | ||
| 97 | Phosphorylation | MEETQQKSNLELLRI HHHHHHHHHHHHHHH | 19413330 | ||
| 121 | Phosphorylation | EPVRFLRSMFANNLV HHHHHHHHHHCCCCE | - | ||
| 125 | Sulfoxidation | FLRSMFANNLVYDTS HHHHHHCCCCEEECC | 3571265 | ||
| 179 | Sulfoxidation | FDTNSHNHDALLKNY CCCCCCCHHHHHHHC | 3571265 | ||
| 214 | Phosphorylation | QCRSVEGSCGF---- HHHCCCCCCCC---- | 29691806 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSH1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSH1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSH1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SOMA_HUMAN | GH1 | physical | 28514442 | |
| ISCA1_HUMAN | ISCA1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...