UniProt ID | ISCA1_HUMAN | |
---|---|---|
UniProt AC | Q9BUE6 | |
Protein Name | Iron-sulfur cluster assembly 1 homolog, mitochondrial | |
Gene Name | ISCA1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 129 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Involved in the maturation of mitochondrial 4Fe-4S proteins functioning late in the iron-sulfur cluster assembly pathway. Probably involved in the binding of an intermediate of Fe/S cluster assembly.. | |
Protein Sequence | MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | RATVRAVSKRKLQPT HHHHHHHHHCCCCCC | 26.26 | 26074081 | |
61 | Phosphorylation | TRGCNGLSYTLEYTK ECCCCCEEEEEEEEE | 19.92 | 28270605 | |
62 | Phosphorylation | RGCNGLSYTLEYTKT CCCCCEEEEEEEEEC | 22.01 | 28270605 | |
63 | Phosphorylation | GCNGLSYTLEYTKTK CCCCEEEEEEEEECC | 15.11 | 28270605 | |
66 | Phosphorylation | GLSYTLEYTKTKGDS CEEEEEEEEECCCCC | 19.35 | 28270605 | |
67 | Phosphorylation | LSYTLEYTKTKGDSD EEEEEEEEECCCCCC | 23.90 | 28270605 | |
69 | Phosphorylation | YTLEYTKTKGDSDEE EEEEEEECCCCCCHH | 32.24 | 29449344 | |
73 | Phosphorylation | YTKTKGDSDEEVIQD EEECCCCCCHHHHHC | 56.44 | 25849741 | |
89 | Ubiquitination | VRVFIEKKAQLTLLG EEEEEEECEEEEEEC | 28.68 | - | |
101 | Phosphorylation | LLGTEMDYVEDKLSS EECCCCHHHHHHCCC | 12.39 | - | |
136 | Ubiquitination | I-------------- C-------------- | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ISCA1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ISCA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ISCA1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ISCA1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...