| UniProt ID | CSE_ARATH | |
|---|---|---|
| UniProt AC | Q9C942 | |
| Protein Name | Caffeoylshikimate esterase | |
| Gene Name | CSE | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 332 | |
| Subcellular Localization |
Cell membrane Peripheral membrane protein . Colocalizes with ACBP2. |
|
| Protein Description | Esterase involved in the biosynthesis of lignin. Hydrolyzes caffeoylshikimate into caffeate and shikimate. Together with 4-coumarate--CoA ligase (4CL), acts on an alternative reaction for the formation of caffeoyl-CoA and bypasses the second reaction of shikimate O-hydroxycinnamoyltransferase (HST). Accepts also 4-coumaroylshikimate as substrate, but with lower activity. According to PubMed:20345607 and PubMed:22915575, posseses monoacylglycerol O-acyltransferase, monoacylglycerol lipase and lysophospholipase activities in vitro. With the association of ACBP2, may promote the degradation of lysophosphatidylcholine and detoxify the peroxidized membrane in response to cadmium-induced oxidative stress. However these results require additional confirmation in vivo.. | |
| Protein Sequence | MPSEAESSANSAPATPPPPPNFWGTMPEEEYYTSQGVRNSKSYFETPNGKLFTQSFLPLDGEIKGTVYMSHGYGSDTSWMFQKICMSFSSWGYAVFAADLLGHGRSDGIRCYMGDMEKVAATSLAFFKHVRCSDPYKDLPAFLFGESMGGLVTLLMYFQSEPETWTGLMFSAPLFVIPEDMKPSKAHLFAYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKIIASNPQRYTGKPRVGTMRELLRKTQYVQENFGKVTIPVFTAHGTADGVTCPTSSKLLYEKASSADKTLKIYEGMYHSLIQGEPDENAEIVLKDMREWIDEKVKKYGSKTA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of CSE_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSE_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSE_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSE_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SYP23_ARATH | SYP23 | physical | 21952135 | |
| CSN5A_ARATH | CSN5A | physical | 21952135 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
