CSAG1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CSAG1_HUMAN
• UniProt AC: Q6PB30
• Protein Name: Putative chondrosarcoma-associated gene 1 protein
• Gene Name: CSAG1
• Organism: Homo sapiens (Human).
• Sequence Length: 78
• Protein Sequence: MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPRREKGPVKEVPGTKGSP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Phosphorylation	DTGLVKMSRKPRASS HCCCEECCCCCCCCC	31.28	29083192
44	Phosphorylation	SRKPRASSPFSNNHP CCCCCCCCCCCCCCC	29.04	29759185
47	Phosphorylation	PRASSPFSNNHPSTP CCCCCCCCCCCCCCC	39.86	20886841
52	Phosphorylation	PFSNNHPSTPKRFPR CCCCCCCCCCCCCCC	50.20	29759185

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CSAG1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CSAG1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CSAG1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.