CS012_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CS012_HUMAN
• UniProt AC: Q9NSK7
• Protein Name: Protein C19orf12
• Gene Name: C19orf12
• Organism: Homo sapiens (Human).
• Sequence Length: 152
• Subcellular Localization: Mitochondrion . Mitochondrion membrane ; Single-pass membrane protein . Endoplasmic reticulum . Cytoplasm, cytosol . In response to oxidative stress, relocates to the cytosol forming aggregates that partially co-localize with mitochondria.
• Protein Sequence: MERLKSHKPATMTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPPGLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQYDD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	DIMKLLCSLSGERKM HHHHHHHHCCCHHHH	26.07	22617229
27	Phosphorylation	MKLLCSLSGERKMKA HHHHHHCCCHHHHHH	23.47	22617229
33	Ubiquitination	LSGERKMKAAVKHSG CCCHHHHHHHHHCCC	35.91	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CS012_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CS012_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CS012_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.