UniProt ID | CRTP1_HUMAN | |
---|---|---|
UniProt AC | A8MQ03 | |
Protein Name | Cysteine-rich tail protein 1 | |
Gene Name | CYSRT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 144 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | EMVVKNPYAHISIPR HHEECCCCCEEECCH | 25159151 | ||
16 | Phosphorylation | KNPYAHISIPRAHLR CCCCCEEECCHHHHC | 25159151 | ||
39 | Phosphorylation | VASTCSSSSEMQPLP HECCCCCCCCCCCCC | 17081983 | ||
40 | Phosphorylation | ASTCSSSSEMQPLPV ECCCCCCCCCCCCCC | 17081983 | ||
52 | Phosphorylation | LPVGPCAPEPTHLLQ CCCCCCCCCCCCCCC | 27642862 | ||
56 | Phosphorylation | PCAPEPTHLLQPTEV CCCCCCCCCCCCCCC | 18212344 | ||
79 | Phosphorylation | NQGAAPIQNQQAWQQ CCCCCCCCCCHHHCC | 17081983 | ||
80 | Phosphorylation | QGAAPIQNQQAWQQP CCCCCCCCCHHHCCC | 17081983 | ||
91 | Phosphorylation | WQQPGNPYSSSQRQA HCCCCCCCCHHHHCC | 28152594 | ||
92 | Phosphorylation | QQPGNPYSSSQRQAG CCCCCCCCHHHHCCC | 28152594 | ||
93 | Phosphorylation | QPGNPYSSSQRQAGL CCCCCCCHHHHCCCC | 28152594 | ||
94 | Phosphorylation | PGNPYSSSQRQAGLT CCCCCCHHHHCCCCE | 28152594 | ||
101 | Phosphorylation | SQRQAGLTYAGPPPA HHHCCCCEECCCCCC | - | ||
102 | Phosphorylation | QRQAGLTYAGPPPAG HHCCCCEECCCCCCC | 18083107 | ||
131 | Phosphorylation | CHCCHCPPFCRCHSC CCCCCCCCCCCCCCC | - | ||
134 | Phosphorylation | CHCPPFCRCHSCCCC CCCCCCCCCCCCCEE | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRTP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRTP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRTP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CPNE8_HUMAN | CPNE8 | physical | 22939629 | |
PRR3_HUMAN | PRR3 | physical | 22939629 | |
RMD3_HUMAN | RMDN3 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...