UniProt ID | CRR12_ARATH | |
---|---|---|
UniProt AC | Q9ZU94 | |
Protein Name | Cysteine-rich repeat secretory protein 12 | |
Gene Name | CRRSP12 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 288 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein. Cell junction, plasmodesma . Co-localizes with the Grapevine fanleaf virus (GFLV) 2B-MP at the base of tubules within modified plasmodesmata. |
|
Protein Description | Modulates cell-to-cell trafficking.. | |
Protein Sequence | MFATKTVLFIAVVSLLGTFSSAAVDTFIYGGCSQEKYFPGSPYESNVNSLLTSFVSSASLYTYNNFTTNGISGDSSSVYGLYQCRGDLSSGSGDCARCVARAVSRLGSLCAMASGGALQLEGCFVKYDNTTFLGVEDKTVVVRRCGPPVGYNSDEMTRRDSVVGSLAASSGGSYRVGVSGELQGVAQCTGDLSATECQDCLMEAIGRLRTDCGGAAWGDVYLAKCYARYSARGGHSRANGYGGNRNNNDDDEIEKTLAIIVGLIAGVTLLVVFLSFMAKSCERGKGGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of CRR12_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRR12_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRR12_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRR12_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SUC9_ARATH | SUC9 | physical | 21423366 | |
PUB10_ARATH | AT1G71020 | physical | 21423366 | |
BLUS1_ARATH | AT4G14480 | physical | 21423366 | |
SERK1_ARATH | SERK1 | physical | 21423366 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...