CRR12_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CRR12_ARATH
• UniProt AC: Q9ZU94
• Protein Name: Cysteine-rich repeat secretory protein 12
• Gene Name: CRRSP12
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 288
• Subcellular Localization: Membrane; Single-pass type I membrane protein. Cell junction, plasmodesma . Co-localizes with the Grapevine fanleaf virus (GFLV) 2B-MP at the base of tubules within modified plasmodesmata.
• Protein Description: Modulates cell-to-cell trafficking..
• Protein Sequence: MFATKTVLFIAVVSLLGTFSSAAVDTFIYGGCSQEKYFPGSPYESNVNSLLTSFVSSASLYTYNNFTTNGISGDSSSVYGLYQCRGDLSSGSGDCARCVARAVSRLGSLCAMASGGALQLEGCFVKYDNTTFLGVEDKTVVVRRCGPPVGYNSDEMTRRDSVVGSLAASSGGSYRVGVSGELQGVAQCTGDLSATECQDCLMEAIGRLRTDCGGAAWGDVYLAKCYARYSARGGHSRANGYGGNRNNNDDDEIEKTLAIIVGLIAGVTLLVVFLSFMAKSCERGKGGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CRR12_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CRR12_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CRR12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CRR12_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUC9_ARATH	SUC9	physical	21423366
PUB10_ARATH	AT1G71020	physical	21423366
BLUS1_ARATH	AT4G14480	physical	21423366
SERK1_ARATH	SERK1	physical	21423366

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.