CRLS1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CRLS1_MOUSE
• UniProt AC: Q80ZM8
• Protein Name: Cardiolipin synthase (CMP-forming)
• Gene Name: Crls1
• Organism: Mus musculus (Mouse).
• Sequence Length: 303
• Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
• Protein Description: Catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG). CL is a key phospholipid in mitochondrial membranes and plays important roles in maintaining the functional integrity and dynamics of mitochondria under both optimal and stress conditions..
• Protein Sequence: MLAWRVARGAWGPLRVALRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRLPGAGPRTHCSGAGKAAPEPAAGGGGAAAQAPSARWVPASAASSYENPWTIPNLLSMTRIGLAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISILYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVIKGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CRLS1_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CRLS1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CRLS1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CRLS1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PINK1_MOUSE	Pink1	physical	24703837

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.