CRLS1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CRLS1_HUMAN
• UniProt AC: Q9UJA2
• Protein Name: Cardiolipin synthase (CMP-forming)
• Gene Name: CRLS1
• Organism: Homo sapiens (Human).
• Sequence Length: 301
• Subcellular Localization: Mitochondrion inner membrane ; Multi-pass membrane protein .
• Protein Description: Catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG). CL is a key phospholipid in mitochondrial membranes and plays important roles in maintaining the functional integrity and dynamics of mitochondria under both optimal and stress conditions..
• Protein Sequence: MLALRVARGSWGALRGAAWAPGTRPSKRRACWALLPPVPCCLGCLAERWRLRPAALGLRLPGIGQRNHCSGAGKAAPRPAAGAGAAAEAPGGQWGPASTPSLYENPWTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWANQRSALGSALDPLADKILISILYVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPTFISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
114	Ubiquitination	WTIPNMLSMTRIGLA CCHHHHHHHHHHCHH	13.82	21890473
126	Ubiquitination	GLAPVLGYLIIEEDF CHHHHHCHHCCCCCC	7.20	21890473
162	Phosphorylation	RNWANQRSALGSALD HCHHHHHHHHHHHHH	20.34	24114839
166	Phosphorylation	NQRSALGSALDPLAD HHHHHHHHHHHHHHH	26.89	24114839
225	Ubiquitination	PTPRTLAKYFNPCYA CCHHHHHHHCCCHHH	54.19	27667366
294	Ubiquitination	SYYHYGRKTVQVIKD HHHHCCCCEEEECCC	49.00	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	FBXO15	Q8NCQ5	PMID:24703837

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CRLS1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CRLS1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PINK1_HUMAN	PINK1	physical	24703837

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.