| UniProt ID | CRIPT_HUMAN | |
|---|---|---|
| UniProt AC | Q9P021 | |
| Protein Name | Cysteine-rich PDZ-binding protein | |
| Gene Name | CRIPT | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 101 | |
| Subcellular Localization | Cytoplasm. Cell junction, synapse. Cell projection, dendritic spine. Colocalizes with DLG4 in asymmetric synapses.. | |
| Protein Description | Involved in the cytoskeletal anchoring of DLG4 in excitatory synapses.. | |
| Protein Sequence | MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Ubiquitination | VCEKCEKKLGTVITP CCHHCHHHCCCEECC | 29.83 | 32142685 | |
| 12 | Phosphorylation | KCEKKLGTVITPDTW HCHHHCCCEECCCCC | 21.12 | 27251275 | |
| 15 | Phosphorylation | KKLGTVITPDTWKDG HHCCCEECCCCCCCC | 15.69 | 21815630 | |
| 18 | Phosphorylation | GTVITPDTWKDGARN CCEECCCCCCCCCCC | 35.30 | 27251275 | |
| 20 | Ubiquitination | VITPDTWKDGARNTT EECCCCCCCCCCCCC | 48.66 | 23000965 | |
| 26 | Phosphorylation | WKDGARNTTESGGRK CCCCCCCCCCCCCEE | 26.79 | 27251275 | |
| 27 | Phosphorylation | KDGARNTTESGGRKL CCCCCCCCCCCCEEC | 31.53 | 27251275 | |
| 29 | Phosphorylation | GARNTTESGGRKLNE CCCCCCCCCCEECCC | 44.44 | 27251275 | |
| 33 | Ubiquitination | TTESGGRKLNENKAL CCCCCCEECCCCCCC | 59.96 | 29967540 | |
| 38 | Ubiquitination | GRKLNENKALTSKKA CEECCCCCCCCCCCC | 38.30 | 33845483 | |
| 50 | Phosphorylation | KKARFDPYGKNKFST CCCCCCCCCCCCCCC | 42.44 | - | |
| 52 | Ubiquitination | ARFDPYGKNKFSTCR CCCCCCCCCCCCCCC | 51.63 | 33845483 | |
| 54 | Ubiquitination | FDPYGKNKFSTCRIC CCCCCCCCCCCCCCC | 44.15 | 29967540 | |
| 57 | Phosphorylation | YGKNKFSTCRICKSS CCCCCCCCCCCCCCC | 14.67 | - | |
| 64 | Phosphorylation | TCRICKSSVHQPGSH CCCCCCCCCCCCCCC | 14.76 | 29457462 | |
| 79 | Acetylation | YCQGCAYKKGICAMC CCCCCHHHCCCHHHC | 26.46 | 26051181 | |
| 79 | Ubiquitination | YCQGCAYKKGICAMC CCCCCHHHCCCHHHC | 26.46 | 29967540 | |
| 80 | Ubiquitination | CQGCAYKKGICAMCG CCCCHHHCCCHHHCC | 40.61 | 33845483 | |
| 88 | Acetylation | GICAMCGKKVLDTKN CCHHHCCCEEECCCC | 34.48 | 25953088 | |
| 94 | Ubiquitination | GKKVLDTKNYKQTSV CCEEECCCCCCCCCC | 58.93 | 33845483 | |
| 97 | Ubiquitination | VLDTKNYKQTSV--- EECCCCCCCCCC--- | 57.40 | 33845483 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRIPT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRIPT_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRIPT_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DLG1_HUMAN | DLG1 | physical | 12070168 | |
| DLG4_HUMAN | DLG4 | physical | 9581762 | |
| CA123_HUMAN | C1orf123 | physical | 26344197 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...