UniProt ID | CRIPT_HUMAN | |
---|---|---|
UniProt AC | Q9P021 | |
Protein Name | Cysteine-rich PDZ-binding protein | |
Gene Name | CRIPT | |
Organism | Homo sapiens (Human). | |
Sequence Length | 101 | |
Subcellular Localization | Cytoplasm. Cell junction, synapse. Cell projection, dendritic spine. Colocalizes with DLG4 in asymmetric synapses.. | |
Protein Description | Involved in the cytoskeletal anchoring of DLG4 in excitatory synapses.. | |
Protein Sequence | MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Ubiquitination | VCEKCEKKLGTVITP CCHHCHHHCCCEECC | 29.83 | 32142685 | |
12 | Phosphorylation | KCEKKLGTVITPDTW HCHHHCCCEECCCCC | 21.12 | 27251275 | |
15 | Phosphorylation | KKLGTVITPDTWKDG HHCCCEECCCCCCCC | 15.69 | 21815630 | |
18 | Phosphorylation | GTVITPDTWKDGARN CCEECCCCCCCCCCC | 35.30 | 27251275 | |
20 | Ubiquitination | VITPDTWKDGARNTT EECCCCCCCCCCCCC | 48.66 | 23000965 | |
26 | Phosphorylation | WKDGARNTTESGGRK CCCCCCCCCCCCCEE | 26.79 | 27251275 | |
27 | Phosphorylation | KDGARNTTESGGRKL CCCCCCCCCCCCEEC | 31.53 | 27251275 | |
29 | Phosphorylation | GARNTTESGGRKLNE CCCCCCCCCCEECCC | 44.44 | 27251275 | |
33 | Ubiquitination | TTESGGRKLNENKAL CCCCCCEECCCCCCC | 59.96 | 29967540 | |
38 | Ubiquitination | GRKLNENKALTSKKA CEECCCCCCCCCCCC | 38.30 | 33845483 | |
50 | Phosphorylation | KKARFDPYGKNKFST CCCCCCCCCCCCCCC | 42.44 | - | |
52 | Ubiquitination | ARFDPYGKNKFSTCR CCCCCCCCCCCCCCC | 51.63 | 33845483 | |
54 | Ubiquitination | FDPYGKNKFSTCRIC CCCCCCCCCCCCCCC | 44.15 | 29967540 | |
57 | Phosphorylation | YGKNKFSTCRICKSS CCCCCCCCCCCCCCC | 14.67 | - | |
64 | Phosphorylation | TCRICKSSVHQPGSH CCCCCCCCCCCCCCC | 14.76 | 29457462 | |
79 | Acetylation | YCQGCAYKKGICAMC CCCCCHHHCCCHHHC | 26.46 | 26051181 | |
79 | Ubiquitination | YCQGCAYKKGICAMC CCCCCHHHCCCHHHC | 26.46 | 29967540 | |
80 | Ubiquitination | CQGCAYKKGICAMCG CCCCHHHCCCHHHCC | 40.61 | 33845483 | |
88 | Acetylation | GICAMCGKKVLDTKN CCHHHCCCEEECCCC | 34.48 | 25953088 | |
94 | Ubiquitination | GKKVLDTKNYKQTSV CCEEECCCCCCCCCC | 58.93 | 33845483 | |
97 | Ubiquitination | VLDTKNYKQTSV--- EECCCCCCCCCC--- | 57.40 | 33845483 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRIPT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRIPT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRIPT_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DLG1_HUMAN | DLG1 | physical | 12070168 | |
DLG4_HUMAN | DLG4 | physical | 9581762 | |
CA123_HUMAN | C1orf123 | physical | 26344197 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...