| UniProt ID | CRBB3_HUMAN | |
|---|---|---|
| UniProt AC | P26998 | |
| Protein Name | Beta-crystallin B3 | |
| Gene Name | CRYBB3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 211 | |
| Subcellular Localization | ||
| Protein Description | Crystallins are the dominant structural components of the vertebrate eye lens.. | |
| Protein Sequence | MAEQHGAPEQAAAGKSHGDLGGSYKVILYELENFQGKRCELSAECPSLTDSLLEKVGSIQVESGPWLAFESRAFRGEQFVLEKGDYPRWDAWSNSRDSDSLLSLRPLNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAINGTWVGYEFPGYRGRQYVFERGEYRHWNEWDASQPQLQSVRRIRDQKWHKRGRFPSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MAEQHGAP -------CCHHHCCH | 9.27 | 8999933 | |
| 2 | Acetylation | ------MAEQHGAPE ------CCHHHCCHH | 25.75 | - | |
| 29 | Phosphorylation | GSYKVILYELENFQG CCEEEEEEEEECCCC | 13.82 | 22817900 | |
| 51 | Phosphorylation | ECPSLTDSLLEKVGS CCCCCCHHHHHHHCC | 29.62 | 24719451 | |
| 103 | Phosphorylation | RDSDSLLSLRPLNID CCCCCCCCCCCCCCC | 27.85 | 24719451 | |
| 128 | Acetylation | NPAFSGRKMEIVDDD CCCCCCCEEEEECCC | 44.39 | 12060738 | |
| 128 | Methylation | NPAFSGRKMEIVDDD CCCCCCCEEEEECCC | 44.39 | 12060738 | |
| 150 | Phosphorylation | GFQDRVASVRAINGT CCHHHEEEEEEECCE | 14.85 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRBB3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRBB3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRBB3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TAB1_HUMAN | TAB1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 609741 | Cataract 22, multiple types (CTRCT22) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Shotgun identification of protein modifications from proteincomplexes and lens tissue."; MacCoss M.J., McDonald W.H., Saraf A., Sadygov R., Clark J.M.,Tasto J.J., Gould K.L., Wolters D., Washburn M., Weiss A., Clark J.I.,Yates J.R. III; Proc. Natl. Acad. Sci. U.S.A. 99:7900-7905(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-29, ACETYLATION ATLYS-128, METHYLATION AT LYS-128, SUSCEPTIBILITY TO OXIDATION, AND MASSSPECTROMETRY. | |
| Methylation | |
| Reference | PubMed |
| "Shotgun identification of protein modifications from proteincomplexes and lens tissue."; MacCoss M.J., McDonald W.H., Saraf A., Sadygov R., Clark J.M.,Tasto J.J., Gould K.L., Wolters D., Washburn M., Weiss A., Clark J.I.,Yates J.R. III; Proc. Natl. Acad. Sci. U.S.A. 99:7900-7905(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-29, ACETYLATION ATLYS-128, METHYLATION AT LYS-128, SUSCEPTIBILITY TO OXIDATION, AND MASSSPECTROMETRY. | |
| Phosphorylation | |
| Reference | PubMed |
| "Shotgun identification of protein modifications from proteincomplexes and lens tissue."; MacCoss M.J., McDonald W.H., Saraf A., Sadygov R., Clark J.M.,Tasto J.J., Gould K.L., Wolters D., Washburn M., Weiss A., Clark J.I.,Yates J.R. III; Proc. Natl. Acad. Sci. U.S.A. 99:7900-7905(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-29, ACETYLATION ATLYS-128, METHYLATION AT LYS-128, SUSCEPTIBILITY TO OXIDATION, AND MASSSPECTROMETRY. | |