CPL4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CPL4_ARATH
• UniProt AC: Q00IB6
• Protein Name: RNA polymerase II C-terminal domain phosphatase-like 4
• Gene Name: CPL4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 440
• Subcellular Localization: Nucleus .
• Protein Description: Processively dephosphorylates 'Ser-2' and/or 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1). This promotes the activity of RNA polymerase II (By similarity). Required for normal plant growth..
• Protein Sequence: MSVASDSPVHSSSSSDDLAAFLDAELDSASDASSGPSEEEEAEDDVESGLKRQKLEHLEEASSSKGECEHPGSFGNMCFVCGQKLEETGVSFRYIHKEMRLNEDEISRLRDSDSRFLQRQRKLYLVLDLDHTLLNTTILRDLKPEEEYLKSHTHSLQDGCNVSGGSLFLLEFMQMMTKLRPFVHSFLKEASEMFVMYIYTMGDRNYARQMAKLLDPKGEYFGDRVISRDDGTVRHEKSLDVVLGQESAVLILDDTENAWPKHKDNLIVIERYHFFSSSCRQFDHRYKSLSELKSDESEPDGALATVLKVLKQAHALFFENVDEGISNRDVRLMLKQVRKEILKGCKIVFSRVFPTKAKPEDHPLWKMAEELGATCATEVDASVTHVVAMDVGTEKARWAVREKKYVVHRGWIDAANYLWMKQPEENFGLEQLKKQLTEEE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CPL4_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CPL4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CPL4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CPL4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NRPB1_ARATH	NRPB1	physical	25041272
NRPB2_ARATH	NRPB2	physical	25041272
NRPB3_ARATH	NRPB3	physical	25041272

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.