| UniProt ID | CP4AB_HUMAN | |
|---|---|---|
| UniProt AC | Q02928 | |
| Protein Name | Cytochrome P450 4A11 | |
| Gene Name | CYP4A11 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 519 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein. Microsome membrane Peripheral membrane protein. |
|
| Protein Description | Catalyzes the omega- and (omega-1)-hydroxylation of various fatty acids such as laurate, myristate and palmitate. Has little activity toward prostaglandins A1 and E1. Oxidizes arachidonic acid to 20-hydroxyeicosatetraenoic acid (20-HETE).. | |
| Protein Sequence | MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIPIARLVLKSKNGIHLRLRRLPNPCEDKDQL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSVSVLSPS ------CCCCCCCHH | 24.09 | - | |
| 4 | Phosphorylation | ----MSVSVLSPSRL ----CCCCCCCHHHH | 15.27 | 29083192 | |
| 7 | Phosphorylation | -MSVSVLSPSRLLGD -CCCCCCCHHHHHCC | 20.76 | 29083192 | |
| 9 | Phosphorylation | SVSVLSPSRLLGDVS CCCCCCHHHHHCCHH | 31.98 | 29083192 | |
| 100 | Phosphorylation | GKVRVQLYDPDYMKV CEEEEEEECCCCEEE | 14.34 | - | |
| 104 | Phosphorylation | VQLYDPDYMKVILGR EEEECCCCEEEEEEC | 12.29 | - | |
| 307 | Phosphorylation | MENGSILSDKDLRAE CCCCCCCCCHHHHHH | 40.73 | - | |
| 394 | Phosphorylation | PGIGRELSTPVTFPD CCCCCCCCCCEECCC | 26.38 | 25072903 | |
| 395 | Phosphorylation | GIGRELSTPVTFPDG CCCCCCCCCEECCCC | 34.11 | 25072903 | |
| 398 | Phosphorylation | RELSTPVTFPDGRSL CCCCCCEECCCCCCC | 30.56 | 25072903 | |
| 440 | Phosphorylation | PFRFAPGSAQHSHAF CCCCCCCCCCCCCEE | 24.56 | - | |
| 485 | Phosphorylation | FELLPDPTRIPIPIA HHCCCCCCCCCCCHH | 48.92 | 28258704 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CP4AB_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CP4AB_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CP4AB_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CYB5_HUMAN | CYB5A | physical | 10660572 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
