CP074_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CP074_HUMAN
• UniProt AC: Q96GX8
• Protein Name: Uncharacterized protein C16orf74
• Gene Name: C16orf74
• Organism: Homo sapiens (Human).
• Sequence Length: 76
• Protein Sequence: MGLKMSCLKGFQMCVSSSSSSHDEAPVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDGEIDPEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	KGFQMCVSSSSSSHD HCCEEECCCCCCCCC	21.41	28450419
17	Phosphorylation	GFQMCVSSSSSSHDE CCEEECCCCCCCCCC	17.53	28450419
18	Phosphorylation	FQMCVSSSSSSHDEA CEEECCCCCCCCCCC	27.08	28450419
19	Phosphorylation	QMCVSSSSSSHDEAP EEECCCCCCCCCCCC	37.50	28450419
20	Phosphorylation	MCVSSSSSSHDEAPV EECCCCCCCCCCCCC	33.37	28450419
21	Phosphorylation	CVSSSSSSHDEAPVL ECCCCCCCCCCCCCC	36.58	28450419
32	Phosphorylation	APVLNDKHLDVPDII CCCCCCCCCCCCCEE	30.08	18669648
34	Phosphorylation	VLNDKHLDVPDIIIT CCCCCCCCCCCEEEC	50.01	18669648
41	Phosphorylation	DVPDIIITPPTPTGM CCCCEEECCCCCCCC	16.89	30266825
44	Phosphorylation	DIIITPPTPTGMMLP CEEECCCCCCCCCCC	34.39	30266825
46	Phosphorylation	IITPPTPTGMMLPRD EECCCCCCCCCCCCC	39.94	30266825
56	Phosphorylation	MLPRDLGSTVWLDET CCCCCCCCEEEEECC	27.38	24719451
63	Phosphorylation	STVWLDETGSCPDDG CEEEEECCCCCCCCC	33.78	27251275
65	Phosphorylation	VWLDETGSCPDDGEI EEEECCCCCCCCCCC	29.87	27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CP074_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CP074_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CP074_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PP2BA_HUMAN	PPP3CA	physical	21516116

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-44 AND THR-46, AND MASSSPECTROMETRY.
PubMed: 18669648