UniProt ID | COS9_YEAST | |
---|---|---|
UniProt AC | P36034 | |
Protein Name | Protein COS9 | |
Gene Name | COS9 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 407 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MQIVRSCNSNNKPLIPSSNWHIAIRMRGDGVKDRSIDVLSLKHFESQKVVLPQDLFMDNFTWMFYEFFKCFTFRTWLLLLLLMWLPGFLSQIKSINRIFPFKLCILVSCLVGIFLPNIYSFSHKSVLTNQLTQFSKEIVEHAPGTDTHDWETVAANLNSYFYENKAWNTEYFFFNAAECQKAFRKVLLEPFSVKKDESSKIKSFGDSVPYIEEALQVYSTEFDKKWKLFNTEKVWSPDNLEHVQLPKKTYRYKFTWVLKRIFNLWLFPAFILFLACIYVSWDKGHLFRILCCGGGFLLMVRVFQNMRPFSMHMEDKMQFLSTIINEQESGANGWDEIAKKMNRYLFEKKVWTSEEFFFDGIDCEWFFNHFFYRLLSTKKPMFDRPLNVELWPYIKEAQLTRKQAPPV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COS9_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COS9_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COS9_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MMP1_YEAST | MMP1 | physical | 16093310 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...