dbPTM

COPD_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COPD_SCHPO
UniProt AC	O74496
Protein Name	Coatomer subunit delta
Gene Name	ret2
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	240
Subcellular Localization	Cytoplasm. Nucleus.
Protein Description	The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins (By similarity)..
Protein Sequence	MVVLAVSIVNRGGKAIISRQFREMSRVRVESLLSSFPALVSEKSQNTTVESDNVRFVYQPLDELYIVLITNLQSNILQDIDTLHLLSQVVTSICSSLEEREILEYAFEIFTAFDEATSLGYRDNVSLTQIKTYLEMESHEEKIQEIVSRNKEIEATEERKRRIKQLELQKKEAARRAAQNLPSADAYESIGYQTVNTTFATSNVEDESAMESYHAAAKASSAPKAKGMQLGKKKNTSLLY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	Phosphorylation	PALVSEKSQNTTVES CHHHCCCCCCCCCCC	25.31	25720772
126	Phosphorylation	LGYRDNVSLTQIKTY CCCCCCCCHHHHHHH	31.77	28889911
133	Phosphorylation	SLTQIKTYLEMESHE CHHHHHHHHHHHCHH	8.82	25720772
138	Phosphorylation	KTYLEMESHEEKIQE HHHHHHHCHHHHHHH	34.58	25720772
237	Phosphorylation	LGKKKNTSLLY---- CCCCCCCCCCC----	26.27	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COPD_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COPD_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COPD_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
COPD_SCHPO	ret2	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COPD_SCHPO

Related Literatures of Post-Translational Modification