UniProt ID | COPD_SCHPO | |
---|---|---|
UniProt AC | O74496 | |
Protein Name | Coatomer subunit delta | |
Gene Name | ret2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 240 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins (By similarity).. | |
Protein Sequence | MVVLAVSIVNRGGKAIISRQFREMSRVRVESLLSSFPALVSEKSQNTTVESDNVRFVYQPLDELYIVLITNLQSNILQDIDTLHLLSQVVTSICSSLEEREILEYAFEIFTAFDEATSLGYRDNVSLTQIKTYLEMESHEEKIQEIVSRNKEIEATEERKRRIKQLELQKKEAARRAAQNLPSADAYESIGYQTVNTTFATSNVEDESAMESYHAAAKASSAPKAKGMQLGKKKNTSLLY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | Phosphorylation | PALVSEKSQNTTVES CHHHCCCCCCCCCCC | 25.31 | 25720772 | |
126 | Phosphorylation | LGYRDNVSLTQIKTY CCCCCCCCHHHHHHH | 31.77 | 28889911 | |
133 | Phosphorylation | SLTQIKTYLEMESHE CHHHHHHHHHHHCHH | 8.82 | 25720772 | |
138 | Phosphorylation | KTYLEMESHEEKIQE HHHHHHHCHHHHHHH | 34.58 | 25720772 | |
237 | Phosphorylation | LGKKKNTSLLY---- CCCCCCCCCCC---- | 26.27 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COPD_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COPD_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COPD_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
COPD_SCHPO | ret2 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...