COA5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: COA5_HUMAN
• UniProt AC: Q86WW8
• Protein Name: Cytochrome c oxidase assembly factor 5
• Gene Name: COA5
• Organism: Homo sapiens (Human).
• Sequence Length: 74
• Protein Description: Involved in an early step of the mitochondrial complex IV assembly process..
• Protein Sequence: MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRGRKGY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MPKYYEDKPQG ----CCCCCCCCCCC	13.25	27642862
5	Phosphorylation	---MPKYYEDKPQGG ---CCCCCCCCCCCC	24.63	27642862
28	Phosphorylation	LGACLLQSDCVVQEG HHHHHHCCCCEEECC	32.71	30576142
37	Phosphorylation	CVVQEGKSPRQCLKE CEEECCCCHHHHHHH	35.85	30266825
43	Ubiquitination	KSPRQCLKEGYCNSL CCHHHHHHHCCCCHH	57.63	29967540
46	Phosphorylation	RQCLKEGYCNSLKYA HHHHHHCCCCHHHHH	6.91	26657352
49	Phosphorylation	LKEGYCNSLKYAFFE HHHCCCCHHHHHHHH	23.76	27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of COA5_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of COA5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of COA5_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.