| UniProt ID | CO8G_HUMAN | |
|---|---|---|
| UniProt AC | P07360 | |
| Protein Name | Complement component C8 gamma chain | |
| Gene Name | C8G | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 202 | |
| Subcellular Localization | Secreted. | |
| Protein Description | C8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol.. | |
| Protein Sequence | MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Pyrrolidone_carboxylic_acid | LAAGSLGQKPQRPRR HHHCCCCCCCCCCCC | 60.59 | - | |
| 21 | Pyrrolidone_carboxylic_acid | LAAGSLGQKPQRPRR HHHCCCCCCCCCCCC | 60.59 | 3676249 | |
| 21 | Pyrrolidone_carboxylic_acid | LAAGSLGQKPQRPRR HHHCCCCCCCCCCCC | 60.59 | 3676249 | |
| 31 | Phosphorylation | QRPRRPASPISTIQP CCCCCCCCCCCCCCC | 26.00 | 24505115 | |
| 34 | Phosphorylation | RRPASPISTIQPKAN CCCCCCCCCCCCCCC | 23.88 | 23312004 | |
| 35 | Phosphorylation | RPASPISTIQPKANF CCCCCCCCCCCCCCC | 25.09 | 23312004 | |
| 35 | O-linked_Glycosylation | RPASPISTIQPKANF CCCCCCCCCCCCCCC | 25.09 | OGP | |
| 103 | Phosphorylation | CWQVRQLYGDTGVLG HHHHHHHHCCCCHHH | 12.48 | - | |
| 132 | Phosphorylation | VVVAETDYQSFAVLY EEEEECCHHHEEEHH | 17.30 | - | |
| 139 | Phosphorylation | YQSFAVLYLERAGQL HHHEEEHHHHCCCCC | 10.42 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CO8G_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CO8G_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CO8G_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SC24B_HUMAN | SEC24B | physical | 28514442 | |
| TMEM2_HUMAN | TMEM2 | physical | 28514442 | |
| SH3G1_HUMAN | SH3GL1 | physical | 28514442 | |
| EDEM2_HUMAN | EDEM2 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
