UniProt ID | CNRG_HUMAN | |
---|---|---|
UniProt AC | P18545 | |
Protein Name | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma | |
Gene Name | PDE6G | |
Organism | Homo sapiens (Human). | |
Sequence Length | 87 | |
Subcellular Localization | ||
Protein Description | Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones.. | |
Protein Sequence | MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MNLEPPKA -------CCCCCCHH | 13.41 | - | |
22 | Phosphorylation | RVAGGPVTPRKGPPK EECCCCCCCCCCCCC | 22.10 | 12624098 | |
25 | Ubiquitination | GGPVTPRKGPPKFKQ CCCCCCCCCCCCHHH | 76.58 | - | |
36 | Dimethylation | KFKQRQTRQFKSKPP CHHHHCHHHHCCCCC | 31.44 | - | |
36 | Methylation | KFKQRQTRQFKSKPP CHHHHCHHHHCCCCC | 31.44 | 24390035 | |
62 | Phosphorylation | PGMEGLGTDITVICP CCCCCCCCCEEEEEC | 29.30 | 12624098 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
62 | T | Phosphorylation | Kinase | ADRBK1 | P25098 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNRG_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNRG_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SRC_HUMAN | SRC | physical | 12624098 | |
ARBK1_HUMAN | ADRBK1 | physical | 12624098 | |
GRB2_HUMAN | GRB2 | physical | 12624098 | |
DYN2_HUMAN | DNM2 | physical | 12624098 | |
BHE40_HUMAN | BHLHE40 | physical | 25416956 | |
LMBL3_HUMAN | L3MBTL3 | physical | 25416956 |
loading...