UniProt ID | CNCG_HUMAN | |
---|---|---|
UniProt AC | Q13956 | |
Protein Name | Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma | |
Gene Name | PDE6H | |
Organism | Homo sapiens (Human). | |
Sequence Length | 83 | |
Subcellular Localization | ||
Protein Description | Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones.. | |
Protein Sequence | MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFGII | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSDNTTLPA ------CCCCCCCCC | 39.30 | 25072903 | |
5 | Phosphorylation | ---MSDNTTLPAPAS ---CCCCCCCCCCCC | 34.40 | 25072903 | |
6 | Phosphorylation | --MSDNTTLPAPASN --CCCCCCCCCCCCC | 36.68 | 25072903 | |
12 | Phosphorylation | TTLPAPASNQGPTTP CCCCCCCCCCCCCCC | 28.73 | 25072903 | |
17 | Phosphorylation | PASNQGPTTPRKGPP CCCCCCCCCCCCCCC | 57.14 | 25072903 | |
18 | Phosphorylation | ASNQGPTTPRKGPPK CCCCCCCCCCCCCCC | 24.99 | 25072903 | |
32 | Dimethylation | KFKQRQTRQFKSKPP CHHHHHHHHHCCCCC | 31.44 | - | |
32 | Methylation | KFKQRQTRQFKSKPP CHHHHHHHHHCCCCC | 31.44 | 24390065 | |
58 | Phosphorylation | PGMEGLGTDITVICP CCCCCCCCCEEEEEC | 29.30 | 12624098 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNCG_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNCG_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNCG_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
COTL1_HUMAN | COTL1 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...