CNBL6_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CNBL6_ARATH
• UniProt AC: Q9C5P6
• Protein Name: Calcineurin B-like protein 6
• Gene Name: CBL6
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 226
• Subcellular Localization: Vacuole membrane ; Lipid-anchor . Tonoplast localization abolished by 2-bromopalmitate (2-BP) treatment.
• Protein Description: Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner..
• Protein Sequence: MMMQCLDGLKHLALILLTCCDADPPKVRQNPKDVARGTVFTVNEIEALYELFKSISKNGLIDKEQFQLVLFKMNTTRSLFADRVFDLFDTKNTGILDFEAFARSLSVFHPNAKFEDKIEFSFKLYDLNQQGYIKRQEVKQMVVRTLAESGMNLSDHVIESIIDKTFEEADTKLDGKIDKEEWRSLVLRHPSLLQNMSLQHLKDVTKTFPNFVFHTIVTDTPSELDG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
125	Phosphorylation	IEFSFKLYDLNQQGY EEEEEEEEECCCCCC	20.98	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CNBL6_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CNBL6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CNBL6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CIPKE_ARATH	SR1	physical	11230129
MTN1_ARATH	MTN1	physical	26259190

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.