dbPTM

CML20_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CML20_ARATH
UniProt AC	O82659
Protein Name	Probable calcium-binding protein CML20 {ECO:0000303\|Ref.6}
Gene Name	CML20 {ECO:0000303\|Ref.6}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	169
Subcellular Localization
Protein Description	Potential calcium sensor..
Protein Sequence	MSSIYRTVSRKEKPRRHHGLTTQKKQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINKMIADVDKDGSGAIDFDEFVHMMTAKIGERDTKEELTKAFQIIDLDKNGKISPDDIKRMAKDLGENFTDAEIREMVEEADRDRDGEVNMDEFMRMMRRTAYGGN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
117	Phosphorylation	LDKNGKISPDDIKRM CCCCCCCCHHHHHHH	26.26	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CML20_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CML20_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CML20_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
TON1B_ARATH	TON1B	physical	18757558
TON1A_ARATH	TON1A	physical	18757558

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CML20_ARATH

Related Literatures of Post-Translational Modification