UniProt ID | CLV3_ARATH | |
---|---|---|
UniProt AC | Q9XF04 | |
Protein Name | Protein CLAVATA 3 | |
Gene Name | CLV3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 96 | |
Subcellular Localization | Secreted, extracellular space . | |
Protein Description | Extracellular signal that regulates meristem maintenance. Acts with CLV1 as a ligand-receptor pair in a signal transduction pathway coordinating growth between adjacent meristematic regions and controlling the balance between meristem cell proliferation and differentiation.; The secreted peptide MCLV3 activates a signal transduction cascade to restrict WUSCHEL (WUS) expression, inducing shoot and root meristem consumption as cells differentiated into other organs.. | |
Protein Sequence | MDSKSFLLLLLLFCFLFLHDASDLTQAHAHVQGLSNRKMMMMKMESEWVGANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNNFQLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
73 | Hydroxylation | HEELRTVPSGPDPLH CHHHCCCCCCCCCCC | 32.72 | 16902141 | |
76 | Hydroxylation | LRTVPSGPDPLHHHV HCCCCCCCCCCCCCC | 44.37 | 16902141 | |
76 | O-linked_Glycosylation | LRTVPSGPDPLHHHV HCCCCCCCCCCCCCC | 44.37 | 19525968 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLV3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLV3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLV3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CLV1_ARATH | CLV1 | physical | 18202283 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...