CLV3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CLV3_ARATH
• UniProt AC: Q9XF04
• Protein Name: Protein CLAVATA 3
• Gene Name: CLV3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 96
• Subcellular Localization: Secreted, extracellular space .
• Protein Description: Extracellular signal that regulates meristem maintenance. Acts with CLV1 as a ligand-receptor pair in a signal transduction pathway coordinating growth between adjacent meristematic regions and controlling the balance between meristem cell proliferation and differentiation.; The secreted peptide MCLV3 activates a signal transduction cascade to restrict WUSCHEL (WUS) expression, inducing shoot and root meristem consumption as cells differentiated into other organs..
• Protein Sequence: MDSKSFLLLLLLFCFLFLHDASDLTQAHAHVQGLSNRKMMMMKMESEWVGANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNNFQLP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
73	Hydroxylation	HEELRTVPSGPDPLH CHHHCCCCCCCCCCC	32.72	16902141
76	Hydroxylation	LRTVPSGPDPLHHHV HCCCCCCCCCCCCCC	44.37	16902141
76	O-linked_Glycosylation	LRTVPSGPDPLHHHV HCCCCCCCCCCCCCC	44.37	19525968

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CLV3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CLV3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CLV3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CLV1_ARATH	CLV1	physical	18202283

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.