UniProt ID | CLC4M_HUMAN | |
---|---|---|
UniProt AC | Q9H2X3 | |
Protein Name | C-type lectin domain family 4 member M | |
Gene Name | CLEC4M | |
Organism | Homo sapiens (Human). | |
Sequence Length | 399 | |
Subcellular Localization |
Isoform 1: Cell membrane Single-pass type II membrane protein . Isoform 2: Cell membrane Single-pass type II membrane protein . Isoform 3: Cell membrane Single-pass type II membrane protein . Isoform 5: Secreted . Isoform 6: Secreted . Isoform |
|
Protein Description | Probable pathogen-recognition receptor involved in peripheral immune surveillance in liver. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. Is a receptor for ICAM3, probably by binding to mannose-like carbohydrates.; (Microbial infection) Acts as an attachment receptor for Ebolavirus.; (Microbial infection) Acts as an attachment receptor for Hepatitis C virus.; (Microbial infection) Acts as an attachment receptor for HIV-1.; (Microbial infection) Acts as an attachment receptor for Human coronavirus 229E.; (Microbial infection) Acts as an attachment receptor for Human cytomegalovirus/HHV-5.; (Microbial infection) Acts as an attachment receptor for Influenzavirus.; (Microbial infection) Acts as an attachment receptor for SARS coronavirus.; (Microbial infection) Acts as an attachment receptor for West-nile virus.; (Microbial infection) Acts as an attachment receptor for Japanese encephalitis virus.; (Microbial infection) Acts as an attachment receptor for Marburg virus glycoprotein.; (Microbial infection) Recognition of M.bovis by dendritic cells may occur partially via this molecule.. | |
Protein Sequence | MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
92 | N-linked_Glycosylation | EQDAIYQNLTQLKAA HHHHHHHHHHHHHHH | 28.25 | UniProtKB CARBOHYD | |
104 | Phosphorylation | KAAVGELSEKSKLQE HHHHHHHCHHHHHHH | 38.38 | 22210691 | |
107 | Phosphorylation | VGELSEKSKLQEIYQ HHHHCHHHHHHHHHH | 34.25 | - | |
113 | Phosphorylation | KSKLQEIYQELTQLK HHHHHHHHHHHHHHH | 8.65 | - | |
120 | Acetylation | YQELTQLKAAVGELP HHHHHHHHHHHCCCC | 25.20 | 7432075 | |
130 | Phosphorylation | VGELPEKSKLQEIYQ HCCCCCHHHHHHHHH | 36.62 | - | |
136 | Phosphorylation | KSKLQEIYQELTRLK HHHHHHHHHHHHHHH | 8.65 | - | |
143 | Acetylation | YQELTRLKAAVGELP HHHHHHHHHHHCCCC | 30.89 | 7432083 | |
153 | Phosphorylation | VGELPEKSKLQEIYQ HCCCCCHHHHHHHHH | 36.62 | - | |
159 | Phosphorylation | KSKLQEIYQELTRLK HHHHHHHHHHHHHHH | 8.65 | - | |
166 | Acetylation | YQELTRLKAAVGELP HHHHHHHHHHHCCCC | 30.89 | 7432091 | |
176 | Phosphorylation | VGELPEKSKLQEIYQ HCCCCCHHHHHHHHH | 36.62 | - | |
182 | Phosphorylation | KSKLQEIYQELTRLK HHHHHHHHHHHHHHH | 8.65 | - | |
189 | Acetylation | YQELTRLKAAVGELP HHHHHHHHHHHCCCC | 30.89 | 7432099 | |
199 | Phosphorylation | VGELPEKSKLQEIYQ HCCCCCHHHHHHHHH | 36.62 | - | |
212 | Acetylation | YQELTELKAAVGELP HHHHHHHHHHHCCCC | 28.24 | 7432107 | |
222 | Phosphorylation | VGELPEKSKLQEIYQ HCCCCCHHHHHHHHH | 36.62 | - | |
228 | Phosphorylation | KSKLQEIYQELTQLK HHHHHHHHHHHHHHH | 8.65 | - | |
361 | N-linked_Glycosylation | YWNSGEPNNSGNEDC HHHCCCCCCCCCCCH | 51.50 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLC4M_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLC4M_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLC4M_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CLC4M_HUMAN | CLEC4M | physical | 11384997 | |
GRN_HUMAN | GRN | physical | 26186194 | |
GRN_HUMAN | GRN | physical | 28514442 | |
GFAP_HUMAN | GFAP | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...