CJ055_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CJ055_HUMAN
• UniProt AC: Q5SWW7
• Protein Name: Uncharacterized protein C10orf55
• Gene Name: C10orf55
• Organism: Homo sapiens (Human).
• Sequence Length: 151
• Protein Sequence: MFLHLDSHSSLERTKPTVVGVDTHMELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPIPKPTLPSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPTPVVLKPPLPPCPISWGESGPAVDGIRRTPAP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	O-linked_Glycosylation	-MFLHLDSHSSLERT -CCEECCCCCCCCCC	31.46	30379171
9	Phosphorylation	FLHLDSHSSLERTKP CEECCCCCCCCCCCC	40.34	29759185
64	Phosphorylation	LAPIPKPTLPSPSRL EECCCCCCCCCCCEE	58.38	30177828
67	Phosphorylation	IPKPTLPSPSRLTLF CCCCCCCCCCEEEEE	38.32	30177828
69	Phosphorylation	KPTLPSPSRLTLFVS CCCCCCCCEEEEEEE	44.23	30177828

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CJ055_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CJ055_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CJ055_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
XPF_HUMAN	ERCC4	physical	26186194
SHPK_HUMAN	SHPK	physical	26186194
XPF_HUMAN	ERCC4	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.