UniProt ID | CHUR_HUMAN | |
---|---|---|
UniProt AC | Q8WUH1 | |
Protein Name | Protein Churchill | |
Gene Name | CHURC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 139 | |
Subcellular Localization | ||
Protein Description | Transcriptional activator that mediates FGF signaling during neural development. Plays a role in the regulation of cell movement (By similarity). Does not bind DNA by itself.. | |
Protein Sequence | MRQPYLSSREVSSSRKRWRTFPVDCVAMCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
74 | Sumoylation | LITNKSLKEEDGEEI EEECCCCCCCCCCEE | 14.12 | - | |
74 | Sumoylation | LITNKSLKEEDGEEI EEECCCCCCCCCCEE | 14.12 | - | |
74 | Ubiquitination | LITNKSLKEEDGEEI EEECCCCCCCCCCEE | 14.12 | - | |
100 (in isoform 2) | Phosphorylation | - | 5.98 | 21406692 | |
124 | Phosphorylation | LCGKAEDTISILPDD HCCCCCHHEEECCCC | 21406692 | ||
126 | Phosphorylation | GKAEDTISILPDDPR CCCCHHEEECCCCHH | 21406692 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CHUR_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CHUR_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CHUR_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ZBTB9_HUMAN | ZBTB9 | physical | 20211142 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...