| UniProt ID | CHAC2_HUMAN | |
|---|---|---|
| UniProt AC | Q8WUX2 | |
| Protein Name | Glutathione-specific gamma-glutamylcyclotransferase 2 {ECO:0000303|PubMed:27913623} | |
| Gene Name | CHAC2 {ECO:0000312|HGNC:HGNC:32363} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 184 | |
| Subcellular Localization | Cytoplasm, cytosol . | |
| Protein Description | Catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide. Acts specifically on glutathione, but not on other gamma-glutamyl peptides.. | |
| Protein Sequence | MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MWVFGYGSLIWKV --CEEEECCCEEEEE | 7.65 | 26503514 | |
| 71 | Ubiquitination | AYRLPVGKEEEVKAY EEEECCCCHHHHHHE | 63.29 | - | |
| 78 | Phosphorylation | KEEEVKAYLDFREKG CHHHHHHEEECHHHC | 10.90 | - | |
| 122 | Ubiquitination | NPDYLGPAPLEDIAE CCCCCCCCCHHHHHH | 21.36 | 24816145 | |
| 142 | Phosphorylation | AGPSGRNTEYLFELA CCCCCCCHHHHHHHH | 25.33 | 20068231 | |
| 144 | Phosphorylation | PSGRNTEYLFELANS CCCCCHHHHHHHHHH | 18.04 | - | |
| 172 | Ubiquitination | FALEKLVKERLEGKQ HHHHHHHHHHHCCCC | 47.77 | - | |
| 178 | Ubiquitination | VKERLEGKQNLNCI- HHHHHCCCCCCCCC- | 27.00 | 24816145 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CHAC2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CHAC2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CHAC2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| DPYD_HUMAN | DPYD | physical | 22939629 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...