UniProt ID | CHAC2_HUMAN | |
---|---|---|
UniProt AC | Q8WUX2 | |
Protein Name | Glutathione-specific gamma-glutamylcyclotransferase 2 {ECO:0000303|PubMed:27913623} | |
Gene Name | CHAC2 {ECO:0000312|HGNC:HGNC:32363} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 184 | |
Subcellular Localization | Cytoplasm, cytosol . | |
Protein Description | Catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide. Acts specifically on glutathione, but not on other gamma-glutamyl peptides.. | |
Protein Sequence | MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MWVFGYGSLIWKV --CEEEECCCEEEEE | 7.65 | 26503514 | |
71 | Ubiquitination | AYRLPVGKEEEVKAY EEEECCCCHHHHHHE | 63.29 | - | |
78 | Phosphorylation | KEEEVKAYLDFREKG CHHHHHHEEECHHHC | 10.90 | - | |
122 | Ubiquitination | NPDYLGPAPLEDIAE CCCCCCCCCHHHHHH | 21.36 | 24816145 | |
142 | Phosphorylation | AGPSGRNTEYLFELA CCCCCCCHHHHHHHH | 25.33 | 20068231 | |
144 | Phosphorylation | PSGRNTEYLFELANS CCCCCHHHHHHHHHH | 18.04 | - | |
172 | Ubiquitination | FALEKLVKERLEGKQ HHHHHHHHHHHCCCC | 47.77 | - | |
178 | Ubiquitination | VKERLEGKQNLNCI- HHHHHCCCCCCCCC- | 27.00 | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CHAC2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CHAC2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CHAC2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
DPYD_HUMAN | DPYD | physical | 22939629 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...