UniProt ID | CF201_HUMAN | |
---|---|---|
UniProt AC | Q7Z4U5 | |
Protein Name | Uncharacterized protein C6orf201 | |
Gene Name | C6orf201 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 140 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MLSNLHELLPNHLMETLYSRKSEEDKKKCENPELSGLERILARHQLPKEINLTPKPNRMPPWKRKIINNVTDGWKKCHLLKRNTKEPPMSTIVVRKLIQKNVPRRHSLRNTSRKLRNLPTTAKGTQTGKSQCLLGISEPT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | LPNHLMETLYSRKSE HHHHHHHHHHHCCCH | 19.61 | 26074081 | |
18 | Phosphorylation | NHLMETLYSRKSEED HHHHHHHHHCCCHHH | 17.53 | 26074081 | |
19 | Phosphorylation | HLMETLYSRKSEEDK HHHHHHHHCCCHHHH | 36.02 | 24719451 | |
75 | 2-Hydroxyisobutyrylation | NNVTDGWKKCHLLKR HHCCCHHHHHHHHHC | 51.56 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CF201_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CF201_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CF201_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...