CF201_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CF201_HUMAN
• UniProt AC: Q7Z4U5
• Protein Name: Uncharacterized protein C6orf201
• Gene Name: C6orf201
• Organism: Homo sapiens (Human).
• Sequence Length: 140
• Protein Sequence: MLSNLHELLPNHLMETLYSRKSEEDKKKCENPELSGLERILARHQLPKEINLTPKPNRMPPWKRKIINNVTDGWKKCHLLKRNTKEPPMSTIVVRKLIQKNVPRRHSLRNTSRKLRNLPTTAKGTQTGKSQCLLGISEPT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	LPNHLMETLYSRKSE HHHHHHHHHHHCCCH	19.61	26074081
18	Phosphorylation	NHLMETLYSRKSEED HHHHHHHHHCCCHHH	17.53	26074081
19	Phosphorylation	HLMETLYSRKSEEDK HHHHHHHHCCCHHHH	36.02	24719451
75	2-Hydroxyisobutyrylation	NNVTDGWKKCHLLKR HHCCCHHHHHHHHHC	51.56	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CF201_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CF201_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CF201_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.