CF015_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CF015_HUMAN
• UniProt AC: Q6UXA7
• Protein Name: Uncharacterized protein C6orf15
• Gene Name: C6orf15
• Organism: Homo sapiens (Human).
• Sequence Length: 325
• Subcellular Localization: Secreted, extracellular space, extracellular matrix.
• Protein Sequence: MQGRVAGSCAPLGLLLVCLHLPGLFARSIGVVEEKVSQNLGTNLPQLGQPSSTGPSNSEHPQPALDPRSNDLARVPLKLSVPASDGFPPAGGSAVQRWPPSWGLPAMDSWPPEDPWQMMAAAAEDRLGEALPEELSYLSSAAALAPGSGPLPGESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWGTLNPSVSWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWGNINRYPGGSWGNINRYPGGSWGNINRYPGGSWGNIHLYPGINNPFPPGVLRPPGSSWNIPAGFPNPPSPRLQWG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
192	Phosphorylation	GAGGKILSQRPPWSL CCCCHHHHCCCCCHH	27.84	22210691
319	Phosphorylation	AGFPNPPSPRLQWG- CCCCCCCCCCCCCC-	24.74	23312004

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CF015_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CF015_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CF015_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SV2B_HUMAN	SV2B	physical	15466855

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.