CENPW_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CENPW_HUMAN
• UniProt AC: Q5EE01
• Protein Name: Centromere protein W
• Gene Name: CENPW
• Organism: Homo sapiens (Human).
• Sequence Length: 88
• Subcellular Localization: Nucleus . Chromosome, centromere . Chromosome, centromere, kinetochore . Nucleus matrix . Nucleus, nucleolus . Constitutively localizes to centromeres throughout the cell cycle, and to the inner kinetochore during mitosis.
• Protein Description: Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation (By similarity). The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres (By similarity). Part of a nucleosome-associated complex that binds specifically to histone H3-containing nucleosomes at the centromere, as opposed to nucleosomes containing CENPA. Component of the heterotetrameric CENP-T-W-S-X complex that binds and supercoils DNA, and plays an important role in kinetochore assembly. CENPW has a fundamental role in kinetochore assembly and function. It is one of the inner kinetochore proteins, with most further proteins binding downstream. Required for normal chromosome organization and normal progress through mitosis..
• Protein Sequence: MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MALSTIVSQRK ----CCHHHHHHHHH	13.42	-
5	Phosphorylation	---MALSTIVSQRKQ ---CCHHHHHHHHHH	26.67	-
8	Phosphorylation	MALSTIVSQRKQIKR CCHHHHHHHHHHHHH	22.03	20860994
72	Ubiquitination	SKCRVINKEHVLAAA HHCEECCHHHHHHHH	37.76	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CENPW_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CENPW_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CENPW_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSN5_HUMAN	COPS5	physical	23926101
FBW1A_HUMAN	BTRC	physical	27861801

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.