| UniProt ID | CEBPD_MOUSE | |
|---|---|---|
| UniProt AC | Q00322 | |
| Protein Name | CCAAT/enhancer-binding protein delta | |
| Gene Name | Cebpd | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 268 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. [PubMed: 7594592] | |
| Protein Sequence | MSAALFSLDSPVRGTPWPTEPAAFYEPGRVDKPGRGPEPGDLGELGSTTPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAAGAGGLELLQGGPTRPPGVGSVARGPLKREPDWGDGDAPGSLLPAQVAVCAQTVVSLAAAAQPTPPTSPEPPRGSPGPSLAPGTVREKGAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKKLPSPPFLPPTGADCR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSAALFSLD ------CCCCCCCCC | 23.42 | - | |
| 2 | Phosphorylation | ------MSAALFSLD ------CCCCCCCCC | 23.42 | 25367039 | |
| 7 | Phosphorylation | -MSAALFSLDSPVRG -CCCCCCCCCCCCCC | 31.92 | 24068923 | |
| 10 | Phosphorylation | AALFSLDSPVRGTPW CCCCCCCCCCCCCCC | 30.50 | 26824392 | |
| 120 | Sumoylation | SVARGPLKREPDWGD CCCCCCCCCCCCCCC | 58.82 | - | |
| 167 | Phosphorylation | SPEPPRGSPGPSLAP CCCCCCCCCCCCCCC | 28.15 | 25159016 | |
| 191 | Phosphorylation | KRGPDRGSPEYRQRR CCCCCCCCHHHHHHH | 18.56 | 25159016 | |
| 232 | Sumoylation | ELSAENEKLHQRVEQ HHHHHHHHHHHHHHH | 63.95 | - | |
| 256 | Phosphorylation | QFFKKLPSPPFLPPT HHHHCCCCCCCCCCC | 56.49 | 26745281 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CEBPD_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CEBPD_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CEBPD_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RB_MOUSE | Rb1 | physical | 20211142 | |
| CERS2_MOUSE | Cers2 | physical | 20211142 | |
| T2FA_MOUSE | Gtf2f1 | physical | 20211142 | |
| RB_MOUSE | Rb1 | physical | 8946919 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
