UniProt ID | CD79A_MOUSE | |
---|---|---|
UniProt AC | P11911 | |
Protein Name | B-cell antigen receptor complex-associated protein alpha chain | |
Gene Name | Cd79a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 220 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . Following antigen binding, the BCR has been shown to translocate from detergent-soluble regions of the cell membrane to lipid rafts although signal transduction through the complex can also occur |
|
Protein Description | Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.. | |
Protein Sequence | MPGGLEALRALPLLLFLSYACLGPGCQALRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKFGVDMPDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLEKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | N-linked_Glycosylation | ENNGRNPNITWWFSL CCCCCCCCEEEEEEC | 48.12 | - | |
68 | N-linked_Glycosylation | WWFSLQSNITWPPVP EEEECCCCCCCCCCC | 23.81 | - | |
176 | Phosphorylation | GVDMPDDYEDENLYE CCCCCCCCCCCCCCC | 32.43 | 22817900 | |
182 | Phosphorylation | DYEDENLYEGLNLDD CCCCCCCCCCCCHHH | 21.38 | 22817900 | |
191 | Phosphorylation | GLNLDDCSMYEDISR CCCHHHCCHHHHHHH | 31.24 | 21841126 | |
193 | Phosphorylation | NLDDCSMYEDISRGL CHHHCCHHHHHHHHC | 8.31 | 22817900 | |
197 | Phosphorylation | CSMYEDISRGLQGTY CCHHHHHHHHCCCCC | 32.39 | 22078222 | |
198 | Asymmetric dimethylarginine | SMYEDISRGLQGTYQ CHHHHHHHHCCCCCC | 50.61 | - | |
198 | Methylation | SMYEDISRGLQGTYQ CHHHHHHHHCCCCCC | 50.61 | 20231378 | |
203 | Phosphorylation | ISRGLQGTYQDVGNL HHHHCCCCCCCCCCC | 12.68 | 21841126 | |
204 | Phosphorylation | SRGLQGTYQDVGNLH HHHCCCCCCCCCCCE | 15.00 | 11449366 | |
219 | Ubiquitination | IGDAQLEKP------ ECCCCCCCC------ | 65.70 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
182 | Y | Phosphorylation | Kinase | FYN | P06241 | PSP |
182 | Y | Phosphorylation | Kinase | LYN | P07948 | PSP |
182 | Y | Phosphorylation | Kinase | SRC-FAMILY | - | GPS |
182 | Y | Phosphorylation | Kinase | SRC-TYPE TYR-KINASES | - | Uniprot |
193 | Y | Phosphorylation | Kinase | SRC-FAMILY | - | GPS |
193 | Y | Phosphorylation | Kinase | SRC-TYPE TYR-KINASES | - | Uniprot |
197 | S | Phosphorylation | Kinase | SYK | P43405 | PSP |
204 | Y | Phosphorylation | Kinase | TYR-KINASES | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CD79A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CD79A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CD79B_MOUSE | Cd79b | physical | 19407814 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Association of SLP-65/BLNK with the B cell antigen receptor through anon-ITAM tyrosine of Ig-alpha."; Engels N., Wollscheid B., Wienands J.; Eur. J. Immunol. 31:2126-2134(2001). Cited for: INTERACTION WITH BLNK, PHOSPHORYLATION AT TYR-204, AND MUTAGENESIS OFTYR-204. | |
"Reconstitution of the B cell antigen receptor signaling components inCOS cells."; Saouaf S.J., Kut S.A., Fargnoli J., Rowley R.B., Bolen J.B.,Mahajan S.; J. Biol. Chem. 270:27072-27078(1995). Cited for: INTERACTION WITH BLK, AND PHOSPHORYLATION AT TYR-182 AND TYR-193. | |
"Dual role of the tyrosine activation motif of the Ig-alpha proteinduring signal transduction via the B cell antigen receptor."; Flaswinkel H., Reth M.; EMBO J. 13:83-89(1994). Cited for: PHOSPHORYLATION AT TYR-182, AND MUTAGENESIS OF TYR-176; TYR-182 ANDTYR-193. |